Conserved Protein Domain Family
PHA00101

?
PHA00101: PHA00101 
internal virion protein B
Statistics
?
PSSM-Id: 177266
View PSSM: PHA00101
Aligned: 15 rows
Threshold Bit Score: 198.158
Threshold Setting Gi: 29366733
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119637780   1 MCWMAAIPLAMQGTS-MIMGGMQGELAKAAQIDQGRRQSWQMLKEMNYTDANLKLESRDLIDSTVQEMTQANMNRVRNMG 79 
77118202    1 MCEPVSIGLGIMAVAgATMSASQQAKAEGAAIDAQNRQAQEMVKQMNYSDANLRMQERDLKEQQMAELTETTLNGIRNQG 80 
17570830    1 MCWMAAIPIAMAGAQ-ALSSQNSADKARVAQTEAGRRQAIEMVKEMNIQNANASLEQRDALEAASSELTSRNMQKVQAMG 79 
30387492    1 MCWVAAIPIALAGAQ-AISGQNAQAKMIAAQTAAGRRQAIELLKQTNIQNADLSLQARSKLEEASSELTSQNMQKVQAMG 79 
9627474     1 MCWAAAIPIAISGAQ-AISGQNAQAKMIAAQTAAGRRQAMEIMRQTNIQNADLSLQARSKLEEASAELTSQNMQKVQAIG 79 
194100503   1 MCWMAAIPLAMQGTS-MIMGGMQGELAKAAQIDQGRRQSWQMLKEMNYTDANLKLESRDLIDSTVQEMTQANMNRVRNMG 79 
194100401   1 MCWSAAIPIALAGAQ-AISGQNTQAKMIAAQTAAGRRQAMEIMRQTNIQNADLSLQARSKLEEASAELTSQNMQKVQAMG 79 
194100292   1 MCWMAAIPIAMQGAS-MIMGGMQGEQAKAAQIDQGRRQSMQMLKEMNYNEANLKLESRDLIDSTVQEMTQSNMNRVRNMG 79 
194100348   1 MCEPVSIGLGIMAVAgATMSASQQAKAEGAAIDAQNRQAQEMVKQMNYSDANLKMQERDLKEQQMAELTETTLNGIRNQG 80 
212671417   1 MCWMAAIPIAMQGAS-MVIGGMQGEQAKAAQIDQGRRQSWQMIKEMNYNDANLKLESRDLLDSTVQDLTQANMNRVRNMG 79 
119637780  80 TIRAAIGEGMLEGNSMDRVQRVTEGDFLRESQGITENYQRDYSVILGKRLANQENTVSQIKEINKSEPKLKGRLEQIIDP 159
77118202   81 MVRAAVAESGLEGNSMDRIERQVEGDTVKERAGITESYNRDYAAIFGNRIANIENTKSAIRG--QGKIIKTSPLAHALNV 158
17570830   80 TIRAAIGEGMLEGESMKRIKRIEEGNYIREANSVTENYRRDYASIFAQQLGRTQSTASQVDAMYKSEAKGKSGLMRVLDP 159
30387492   80 SIRAAIGESMLEGSSMDRIKRVTEGQFIREANMVTENYRRDYQAIFAQQLGGTQSAASQIDEIYKSEQKQKSKLQMVLDP 159
9627474    80 SIRAAIGESMLEGSSMDRIKRVTEGQFIREANMVTENYRRDYQAIFAQQLGGTQSAASQIDEIYKSEQKQKSKLQMVLDP 159
194100503  80 TIRAAIGEGMLEGNSMDRVQRVTEGDFLRESQGITENYQRDYSVILGKRLANQENTVSQIKEINKSEPKLKGRLEQIIDP 159
194100401  80 SIRAAIGESMLEGSSMDRIKRVTEGQFIREANMVTENYRRDYQAIFAQQLGGTQSAASQIDEIYNSEQKQKSKLQMVLDP 159
194100292  80 TIRAAIGEGMLEGNSMERVTRVTEGDFLRESQGLTENYQRDYSVILGKRLANHENTVSQINEINKSEPKLKGKLEQIIDP 159
194100348  81 MVRAAVAESGLEGNSMDRIERQVKGDTVKERAGITESYNRDYAAIFGNRIANIENTKSAIRG--QGKIIKTSPLAHALNV 158
212671417  80 TIRAAIGEGMLEGNSMERVARVTEGDFLRESQGITENYQRDYSVILGKRLANRENTVSQINEINKSEPRLKGKLEQIIDP 159
119637780 160 LGMgMGQLAGIATSGGLFDGKSTKKaTTKVKAPGVK 195
77118202  159 ANAgMQGYAAGKSISGASSSGGS---APISAAKGTP 191
17570830  160 LSI-MGQEAASQYAAGGFDKKGGNQaAPISAAKGTK 194
30387492  160 LAV-MGSSAASAYASGAFDSKSTTK-APIVAAKGTK 193
9627474   160 LAI-MGSSAASAYASGAFDSKSTTK-APIVAAKGTK 193
194100503 160 LGMgMGQLAGIATSGGLFDSKSTKKaTTKVKAPGVK 195
194100401 160 LAA-MGSSAASAYASGAFDSKSTTK-APIVAAKGTK 193
194100292 160 LGLgLTKLVDVATAGSPLTNKLGKKvASKVKASDAK 195
194100348 159 TNAgMQGYAAGKSISGASSSDGA---APISAAKGTP 191
212671417 160 LGLgLTKLVDVATAGSPLTNKLGKKaASKVKASDAK 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap