Conserved Protein Domain Family
PHA00099

?
PHA00099: PHA00099 
minor capsid protein
Statistics
?
PSSM-Id: 164781
View PSSM: PHA00099
Aligned: 7 rows
Threshold Bit Score: 198.65
Threshold Setting Gi: 9629149
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085142   1 MKKIELRPNGTK-LVHTVNELPPETDQSfgkECDINFIVKKFIKTGQITHL----ARRQGFYGDQSSIPDFQTAMDTVTK 75 
47566145   2 FKSAYSEKKSVK-MKFTQKSLTQQHNKD---ECDINNIVAKLNATGVLEHV----ERRSPRYMDCMDPMEYSEALNVVIE 73 
17402853   2 FKSAYSEKKSVK-MKFTQKSLTQQHNKD---ECDINNIVAKLNATGVLEHV----ERRSPRYMDCMDPMEYSEALNVVIE 73 
9629149    3 FRTIYDEERPAPvLECKDESLCLAYQCT---ETSIEKLVKLANQNPSYLHAfagdPTRQPEYGECPSPLDYQDALEIVAR 79 
9634953    2 FKSAYSEKKSVK-MKFTQKSLTQQHNKD---ECDINNIVAKLNATGVLEHV----ERRSPRYMDCMDPIEYSEALNVVIE 73 
77020118   2 FKSAYSEKKSVK-MKFTQKSLTQQHNKD---ECDINNIVAKLNATGVLEHV----ERRSPRYMDCMDPMEYSEALNVVIE 73 
9791182    2 FKSAYSEKKSVK-MKFTQKSLTQQHNKD---ECDINNIVAKLNATGVLEHV----ERRSPRYMDCMDPMEYSEALNVVIE 73 
12085142  76 AQQAFDELPAHMRKRFANSPHELMQFLQDPKNRDEAISLGLMeMVETPQQAPQSTTNQTTTKPAPASGEPTPVPTP 151
47566145  74 AQEQFDSLPAKIRERFGNDPEAMLDFLSREENYEEAKALGFV-YEDGTSGAPQTLFEAGPKDDQNVANQEPGLAQK 148
17402853  74 AQEQFDSLPAKVRERFGNDPEAMLDFLSREENYEEAKALGFV-YEDGTSGAPHTFCEADPKDDQNVANQEPGLAQK 148
9629149   80 GEEAFYSLPANIRVNFSN-PMEFLSWLEDPANYDEVEKLGLL----DPEKVQIRKSKLQKDQKEEVSSEEK----- 145
9634953   74 AQEQFDSLPAKVRERFGNDPEAMLDFLSREENYEEAKALGFV-YEDGTSGAPQTFFEAGPKDDQNVANQEPGLAQK 148
77020118  74 AQEQFDSLPAKIRERFGNDPEAMLDFLSREENYEEAKALGFV-YEDGTSGAPQTFFEADPKDDQNVANQEPGLAQK 148
9791182   74 AQEQFDSLPAKVRERFGNDPEAMLDFLSREENYEEAKALGFV-YEDGTSGAPQTFFEADPKDDQNVANQEPGLAQK 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap