Conserved Protein Domain Family
K

?
PHA00097: K 
protein K
Statistics
?
PSSM-Id: 164779
View PSSM: PHA00097
Aligned: 4 rows
Threshold Bit Score: 56.4106
Threshold Setting Gi: 89888102
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626376   1 MSRKIILIKQELLLLVYELNRSGLLAENEKIRPILAQLEKLLLCDLSPSTNDSVKN 56 
89888615  1 MKPKTTLILQELLLLTYELNRSGLLVENEEIQSELKKFEKLLLRHLSPSPERTGKD 56 
89888102  1 MKLKTTLLMQELLLLTYDLNRSGLLVENEELQSQLKELEGVLLRNLSPSSQRGSKD 56 
9626341   1 MKPKTTLLLQELLLLTYELNRSGLLVENEEIQSQLKKLEVVLLCNLSPSSQRAGKN 56 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap