Conserved Protein Domain Family
G

?
PHA00010: G 
major spike protein
Statistics
?
PSSM-Id: 164776
View PSSM: PHA00010
Aligned: 7 rows
Threshold Bit Score: 229.281
Threshold Setting Gi: 89888654
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625364     1 MYQNFVTKHDTAIQTSRFSVTgnvipAAPTGNIPVINGGSItaERAVVNLYANMNVsTSSDGSFIVAMKVDTSPTDPNCV 80 
9626347     1 MFQKFISKHNAPINSTQLAAT-----KTPAVAAPVLSVPNL--SRSTILINATTTA-VTTHSGLCHVVRIDETNPTNHHA 72 
9626382     1 MFQTFISRHNSNFFSDKLVLTs----VTPASSAPVLQTPK---ATSSTLYFDSLTV-NAGNGGFLHCIQMDTSVNAANQV 72 
89888654    1 MFQVYVSKHVAPFTSVNRAFS-----IAPAANPEVVNSGEIvaGRSTFRIASSIAS-ASNGSGFAFVQMMDPNSPDSQQV 74 
89888104    1 MFQTYLSKHNSPLTSLSITAT-----KTPAAAAPIISTPEL--SRSTIFAGLTLTA-ATTHSGVAHVVRIDETNPTDNQV 72 
89888617    1 MFQKFIKKHNAPLTSQPAISKa----VTPSMTAAPLVTTPL--GVSSTQLFLELTT-TAAAGGFAYAIRVDNSNPTDNQV 73 
242346751   1 MYQNFVTKHDTAIQTSRFSVTgsitpVAPTGNIPVINAGNItaEHAVVNLYANLTAgTSSDGSFIVAMKVDTSPSDPNCV 80 
9625364    81 ISAGVNLSfAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEmSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSA 160
9626347    73 LSIAGSLS-NVPADMIAFAIRFEVADGVVPTAVPALYDVYPIE-TFNNGKAISFKDAVTIDSHPRTVGNDVYAGIMLWSN 150
9626382    73 VSVGADIAfDADPKFFACLVRFESS--SVPTTLPTAYDVYPLN-GRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSN 149
89888654   75 FSVAASLSfSVDSNYIPCVVRFESTVAQPTSFDIATADFIPVEaSALSPRALSVRDCVTVDVKPRTEGNNVFVGVVFFSA 154
89888104   73 LSVAASLS-GVPSDAIAIAIRFEVADGTVPTALPALYSAYPVE-FFTSGAALSCKDAVSIPTHPVTAGNDVYAGILIWSK 150
89888617   74 FSVCAHITsDVDPKYIACLVRFEVTAGTTPTAMPPVYDAYPIA-GYYDAGSYTVEDCATIPTHAVSSGNDVYVGLMLFSR 152
242346751  81 ISAGVNLSfAGTSYPIVGIVRFESAFDQPTSIAGSQIEHYPIEmSVGSGGVCSARDCATVDIHPRTFGNNVFVGVICSSA 160
9625364   161 KWTSGRVIGTIATTQVIHEYQVLQPLK 187
9626347   151 AWTASTISGVLSVNQVNREATVLQPLK 177
9626382   150 -FTATKCRGLVSLNQVIKEIICLQPLK 175
89888654  155 AANAGNVTGVVSMAQVDHEVTALQPLK 181
89888104  151 SWSAGVVSGLLSVNQVNRETTVLQPLK 177
89888617  153 MWPVAKLSGIASLNQVNKEVTVLQPLK 179
242346751 161 KWTSGRVLGTIATTQVIREYQVLQPLK 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap