Conserved Protein Domain Family
F

?
PHA00009: F 
capsid protein
Statistics
?
PSSM-Id: 164775
View PSSM: PHA00009
Aligned: 7 rows
Threshold Bit Score: 857.626
Threshold Setting Gi: 9626381
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625363     1 MSNVQTSAEREIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLAIDSKVDFFTFYIPHRHVYGD 80 
89888655    1 MSNVQTSAERIPHDLSHLVFDAGKIGRLKVVSWTPVVAGDSFELDMIGAIRLSPLRRGLAVDSRVDLFTFYVPHRHVYGE 80 
9626381     1 MSNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGE 80 
89888103    1 MSNVQTSAERIPHDLSHLVFEAGKIGRLKTISWTPVVAGDSYETEMVGAIRLSPLRRGLAVDSRVDVFTFYIPHRHVYGQ 80 
9626346     1 MSNVQTSADRVPHDLSHLVFEAGKIGRLKTISWTPGGAGDSFECDMVGAIRLSPLRRGLAVDSRVDIFPFYIPHRHIYGQ 80 
89888616    1 MSNVQTSADRIPNDLSHLVFEAGKIGRLKTISWTPVVAGDSFETEMVGAIRLSPLRRGLAVDSRVDIFSFYIPHRHIYGQ 80 
242346750   1 MSNVQTSAEREIVDLSHLAFDCGMIGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLAIDSKVDFFTFYIPHRHVYGD 80 
9625363    81 QWIQFMRDGVNAQPLPSVTCNRYPDHAGYVGTIVPANNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARYR 160
89888655   81 QWIDFMKQGVDAAPLAPVQCSRGWDSAQYLATIPSSNLKVPKFLHQGYLNIYNNYFKAPWMDDLTYANPSNMEGEDVRFG 160
9626381    81 QWIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYG 160
89888103   81 QWIDFMKTGVNATPLAPVTCSSGWDSAAYLGTIPSTNLKVPKFLHQSYLNIYNNYFKPPWSNDLTYANPSNMPAEDYKWG 160
9626346    81 QWINFMKDGVNASPLPPVTCSSGWDSAAYLGTIPSSTLKVPKFLHQGYLNIYNNYFKPPWSDDLTYANPSNMPSEDYKWG 160
89888616   81 EFIEFMKAGVNATPLAPVTTASGWDASAYLGTIPSSNLKVPKFLHQGYLNIYNNYFKPPWDADLTYANPSNMPEQDYKWG 160
242346750  81 QWIQFMRDGVDAAPLPSVTTTQYPDDAGYVGTIVPKSNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLDRDDSRYG 160
9625363   161 FRCCHLKNIWSAPLPPETKLAEEMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMH 240
89888655  161 VRACNLKTIWTAPLPPDTETSHSMETETNSIDIMGLQAAYAQLHTEQERDYFMTRYRDIVNEFGGSTSYDADNRPLLVMH 240
9626381   161 FRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHDVISSFGGKTSYDADNRPLLVMR 240
89888103  161 VRVANLKSIWTAPLPPDSLTKQDMTTGATTIDIMGLQAAYAKLHTEQERDYFMTRYRDIMKDFGGHTSYDGDNRPLLLMR 240
9626346   161 VRVANLKSIWTAPLPPDTRTSENMTTGTSTIDIMGLQAAYAKLHTEQERDYFMTRYRDIMKEFGGHTSYDGDNRPLLLMR 240
89888616  161 VRVANLKSIWTAPLPPNSKTSETMTTGATSIDIMGLQAAYAKLHTQQERDYFMTRYRDIMKDFGGHTSYDGDNRPLLLMR 240
242346750 161 FRCCHLKTIWSAPLPPETKLAEQMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMH 240
9625363   241 TDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEHHYLAGKSQLTYTDLAGDPAL 320
89888655  241 SEFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFCPEHGTMFTLALVRFPPTHEMEMHYLVGKEDLTYTDLACDPAL 320
9626381   241 SNLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVL 320
89888103  241 SEFWASGYDVDGTDQTSLGQFSGRVQQTFNHKVPRFYVPEHGVIMTLSVTRFPPTHEMEMHYLVGKESLTYTDIACDPAL 320
9626346   241 SEFWASGYDVDGTDQSSLGQFSGRVQQTFNHKVPRFYVPEHRVIMTLAVTRFPPTHEMEMHYLVGKENLTYTDIACDPAL 320
89888616  241 SEFWASGYDVDGTDQSSLGQFSGRVQQTFNHKVPRFYVPEHGVIMTLAVTRFPPTHEMEMHYLVGKESLTYTDLACDPAL 320
242346750 241 TDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLMLVRFPPISPLEHHYLVGRNNLTYTDLAGDPAL 320
9625363   321 IGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYVNFKYHDLHGFPFLDDAPGTstgdNLQEAILVRHQDYDACFQ 400
89888655  321 MANLPPREVNMSQFFHSGSASAKFKIAEGQWYRMQPDRVALPYNYLDGFPFYSAIPSD----DIKQRVLVNTDNYDEVFQ 396
9626381   321 YGNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSG----DLQERVLIRHHDYDQCFQ 396
89888103  321 MANLPPREIEVKDLFHSAGTG-KFKIAEGQWYRTQPDRVAFPYNALDGFPFYSELPSN----DILERVLVRTDNYDEIFQ 395
9626346   321 MANLPPREVSLKEFFHSSPDSAKFKIAEGQWYRTQPDRVAFPYNALDGFPFYSALPST----ELKDRVLVNTNNYDEIFQ 396
89888616  321 MANLPPREVSLKEFFHSSPDSAKFKIAEGQWYRTQPDRVAFPYNALDGFPFYSALPST----DLKQRVLVNTDNYDEIFQ 396
242346750 321 IGNLPPREISYQDLFRDGRPGIKIKVAESIWYRTHPDYVNYKYQLLEGFPFLDDAPGTtsgdDLQKAILIDHNDYNACFQ 400
9625363   401 SQQLLQWNKQARYNVSVYRHMPTVRDSIMTS 431
89888655  397 SMQLAHWNMQTKFNCTIYRNMPTTRDSIMTS 427
9626381   397 SVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS 427
89888103  396 SMQLAHWNMQTKFNTTVYRHMPTTRDGIMTS 426
9626346   397 SMQLAHWNMQTKFNINVYRHMPTTRDSIMTS 427
89888616  397 SMQLAHWNMQTKFNTTVYRHMPTTRDSIMTS 427
242346750 401 SQQLLQWNNQARYNVNVYRHIPTVRDSIMTS 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap