Conserved Protein Domain Family
E

?
PHA00007: E 
cell lysis protein
Statistics
?
PSSM-Id: 164774
View PSSM: PHA00007
Aligned: 7 rows
Threshold Bit Score: 73.8446
Threshold Setting Gi: 242346748
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626344    1 MEHWTLSGILAFLLLLSLFLPSLLITFIPLTSKPPVSSWKVLSLPKTSSMVLNAPLKPLNCSPSLFLFAPETKILSVTLK 80 
89888100   1 MELWTLWDTLAFLLLLSLLLPSLLIMFIPLTFKRHVLLWKALNSPKTSLMVSMPRLKPLNSSRLPCVYAPETLSLLLTQK 80 
9625361    1 MERWTLLDILAFLLLLSLLLPSLLIMFIPSMYKQHASLWKARSLAKTLSMASSARLTPLSSSRTPCVLKQDSKKL----- 75 
89888657   1 MEHWTLWDTLAFLLLLSLLLPSLLIMFIPSTFRRPASSWKALSLRKTLLMASSVRLKPLSSSRTPCVLRPDSKKRF---- 76 
89888613   1 MVHWTLSDTLAFLLLLSLLLPSLLIMFIPLTSRQHVLLWKAPSSPKILSMVLTSQLRPLNYSLLPCVYAPETLTMLHMQK 80 
9626379    1 MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNLRKTLLMASSVRLKPLNCSRLPCVYAQETLTFLLTQK 80 
242346748  1 MERWTLSAILAFLLLLSLLLPSLLIMFIPSTFRQHASLWKARSLAKTLLMASSVRLTPLSSSRTPCVLRQDSKKL----- 75 
9626344   81 QTSVNSYALKV 91 
89888100  81 TMRVKNCALKE 91 
9625361      -----------    
89888657     -----------    
89888613  81 LTYVNNYVLKE 91 
9626379   81 KTCVKNYVRKE 91 
242346748    -----------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap