Conserved Protein Domain Family
D

?
PHA00006: D 
external scaffolding protein
Statistics
?
PSSM-Id: 164773
View PSSM: PHA00006
Aligned: 7 rows
Threshold Bit Score: 289.915
Threshold Setting Gi: 242346747
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626343     2 SKSNESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFISAV 81 
9626378     2 SQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAV 81 
89888099    1 MKANENAVAFQTAIASIKLIQASSVLDLTEDDFEFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPIEFIAAV 80 
89888658    2 SNLVATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAV 81 
89888612    1 MNSNESAVAFATALASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAV 80 
9625360     1 -MNIVSDVNYATSVAALRMLQASAVLDVTEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAV 79 
242346747   1 -MNIVSDVNYATSVAALRMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGALDFVGYPRFPAPVEFIAAV 79 
9626343    82 IAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIREQLRAQGVM 152
9626378    82 IAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM 152
89888099   81 IAYYVHPVNIQTACLIMEGAEFTENIINGVDAPVKAAELFAFTLRVRAGNTELITYAENNAREKLRAQGVM 151
89888658   82 IAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENARQKLRASGVM 152
89888612   81 IAYYVHPVNIQTACLIMEGAEFTENIINGIDQPVKAAELFAFTLRVRAGNTDHVTHAETNVREQLRAQGVM 151
9625360    80 IAYYVHPVNVQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVMDAEENARQKLRANGLK 150
242346747  80 IAYYVHPVNIQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVIDAEENARQKLRANGLK 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap