Conserved Protein Domain Family
PDDEXK_2

?
pfam12784: PDDEXK_2 
PD-(D/E)XK nuclease family transposase
Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.
Statistics
?
PSSM-Id: 403861
View PSSM: pfam12784
Aligned: 21 rows
Threshold Bit Score: 195.557
Threshold Setting Gi: 81411593
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q24RR6         15 KIDYAFKLIFGKE-G-NEAILIAFLNAALKlPQERRIEAITIMNPELNKEYQGDKKSILDVRAETSEGMQINIEIQLSNQ 92  Desulfitobacte...
jgi:Amet_0743   9 MNDFVFKALFGREdAtSKQLLIELLNDTLRaKGEDLIASVKYLNPFNYKEYEFDKLSVLDIKAETEKGERVNIEVQVKPE 88  Alkaliphilus m...
Q2FSM1         22 KNDYVFRYLLGEE-G-NEELLTSLISAILG----RRITHATIKNPYILKLYYDTKECILDIKAEIDENILVDIEMQLCNS 95  Methanospirill...
WP_012508639    7 RVDFAFKKLFGSE-E-NKDLLISLINAIVS--EEDQVVEIELKNPYNLADYRAGKISILDIKAKAENGRWFNVEMQISED 82  Pelodictyon ph...
Q73QP0         10 RNDYAFKRVFGVE-E-NKDVLQDLLECILD-IQPEDIAGLELLDKEFHKDSISDKTGVLDVKLRLKNNTIIDIEIQNRWN 86  Treponema dent...
Q73N12         10 RNDYAFKRVFGVE-E-NKDVLQDLLECILD-IPPETIAGLELLDKEFHKELLSEKLGILDIKLRLKDGTFVDIEIQNSWH 86  Treponema dent...
Q73K05         12 RNDYAFKRIFGTE-E-NTDILQDLLECILD-ILPENIAGLELLDKEFHKEILTEKLGILDIKLRLKDKTIINIEIQNRWR 88  Treponema dent...
Q8XNB3          9 QIDFVFKKIFGTE-K-NKPILINFLNAVIK--PTTPIKDVEIKNNDIDKDFLEDKFSRLDVKATTSNKEHINIEIQVKNE 84  Clostridium pe...
Q24PT3          8 INDYLFKWVFGRP-E-NKEILLSFLNSVLSpNGQDELADITLAERELDPEHIHDKLSRLDILGKGNDGSIINIEVQIANQ 85  Desulfitobacte...
Q73J06         11 KTDWVFKLMFSKGeE-GNKALISFLNAFLE-DSYGKINKAEIINTELIRDRPSGETYRLDFLIKTDNGLIIDLEMQQFWK 88  Treponema dent...
Q24RR6         93 YDMEKRSLYYWAEMYSRQIREGMAYKELAKAVTINILD-FNYLKQTSNYHNVFHLYEDEEKF--QLTDALEMHFMELPKL 169 Desulfitobacte...
jgi:Amet_0743  89 VSYRKRSLYYWAKTYAETIGEAEPYEELKKTIVINIMD-YDAIHESKKLHTHFKLLEREEHF--TLTEDLQIHYLEVPKL 165 Alkaliphilus m...
Q2FSM1         96 PELINRILLYWSRLYASQMKAGDGYHVLKKTISILILDdDPYHTD--DFHVCSRIINCVQKF--ELTDLLEIHILELPKV 171 Methanospirill...
WP_012508639   83 YNFDKRAIFYWAKLVTEQLSEGMMYKELKKTISINILD-YNFVPDTTDVHSCYKIINTATGKddRLHDVFELHYIELKKF 161 Pelodictyon ph...
Q73QP0         87 SEFVQRTIFYWAKMYTENLKTGEVYTKLPKCITINIVG-EGFDLN-SLIHSEYNVVEKHLND--RLSDELEIHFLNLAKV 162 Treponema dent...
Q73N12         87 FDFPERTLYYWSKMYNENIKQGQDYTKLPKCITINLIG-KDFDKN-KRLHNKYLVLEKDTKE--PLVSKLEIHILNLEKA 162 Treponema dent...
Q73K05         89 GDFPERSVYYWSKMYNESIKQGQDYTNLPKCITINLIG-KGFNKN-KRLHNKYFVMEKDTKE--PLFSKLEIHIINLETA 164 Treponema dent...
Q8XNB3         85 YNMIQRTLYYWSKMYSEQIQNRDNYSKLERTVCINILN-FKYLKN-DKYHNAYRLKEITSNE--ELTDLQEIHFIELPKF 160 Clostridium pe...
Q24PT3         86 YDIDKRTLYYWAKLYQGQLQKGQRYKDLSRTITVNVLN-FGFLPDSQKYHSMFSLYEAHSGY--RLNRDLEIHFLELSKW 162 Desulfitobacte...
Q73J06         89 TNYHRRSQMYLMRLASRFLK--TEPKEDDFLYAISLSV-FGCDVP--KNAELVRMSES---------SIIQYLYVELNEL 154 Treponema dent...
Q24RR6        170 LAKWRNREISpwe-neLVRWLLLLEGADNQEILQTLEeiamKDPVLHQAMTAWEETSDDPRIREAYFDRRKAVLDEKAAI 248 Desulfitobacte...
jgi:Amet_0743 166 AEAKQIEALEg-----IELWIAFLKEAGKAGNEEKIErlkrRSESMSKVIESLETVSADEKLLEAYRAREKARRDEISKL 240 Alkaliphilus m...
Q2FSM1        172 HKRREQDTNDk-----LIPWMNFLYAQTREELDMASE----ANPVIRKATDMLTAMSRDEEERLRYEAREEFLFDQQYGL 242 Methanospirill...
WP_012508639  162 NKLHHEISST------LDRWTTFLTTAHQLDREHTPKel-aVDKNIVKAIAAIDRM-FNEEERQVYEVRKQSLVDAESKI 233 Pelodictyon ph...
Q73QP0        163 KEQDENIESDekk-kkLYNWLKFIETDDEEVRNMLAQ----ESPMMRKANSTIELMEMSPKEKWLYENRMKYEHDKASWK 237 Treponema dent...
Q73N12        163 KLLKEAQCKDnkt-krLLNWLKFIETDDREVREMLEQ----ESPMMAKANTAISVMEMSSKDKWLYDSRMKYEHDRASCI 237 Treponema dent...
Q73K05        165 KLLEESNYTDikt-krLLSWLKFIETDDREVRKMLAQ----NSKTMKKANAAIEVMEMSPRDKWLYESRMKYQHDMASEK 239 Treponema dent...
Q8XNB3        161 NEIGNKENVDvekmdaLEKWLEFLVEPESNTVRQLEL----SNEEIKLAKSELYRLSMDSKEREQYNMREKAIYDRISAL 236 Clostridium pe...
Q24PT3        163 KALSVKPKTR------LDKWLMYLSNTNPQEMEEIAM----SEPAIRKALTAEEIFLKQDKERYLYEMREKALLDHVSAI 232 Desulfitobacte...
Q73J06        155 IVYTMKKRLEey--slKDFWIRFLANYEEDKKSGMLEelckLEEGIKMAEATLFRVTDEERRMAIELSDEKY----RMYV 228 Treponema dent...
Q24RR6        249 REA 251 Desulfitobacterium hafniense Y51
jgi:Amet_0743 241 AYA 243 Alkaliphilus metalliredigens QYMF
Q2FSM1        243 QAA 245 Methanospirillum hungatei JF-1
WP_012508639  234 ASA 236 Pelodictyon phaeoclathratiforme
Q73QP0        238 HVG 240 Treponema denticola
Q73N12        238 SEG 240 Treponema denticola
Q73K05        240 HEG 242 Treponema denticola
Q8XNB3        237 ESs 239 Clostridium perfringens
Q24PT3        233 EGA 235 Desulfitobacterium hafniense Y51
Q73J06        229 EDE 231 Treponema denticola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap