4AI6


Conserved Protein Domain Family
AAA_9

?
pfam12781: AAA_9 
Click on image for an interactive view with Cn3D
ATP-binding dynein motor region D5
The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D5 ATP-binding region of the motor, but has lost its P-loop.
Statistics
?
PSSM-Id: 403859
View PSSM: pfam12781
Aligned: 408 rows
Threshold Bit Score: 123.317
Threshold Setting Gi: 122094358
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4AI6_B              1981 KWlE-CGLDKNDYFLENMSIVMns------qDAVPFLLDPSSHMITVISN---------YygnktvLLSFLEe-gFVKR- 2042 Schist...
Q170I1               375 TWcS-LGLPKDGLTVENATILLnc------nLRSPLVVDPQGEIRRWLVQ---------------------QdtkLISYn 426  yellow...
Q0E8P6              3137 IWeS-QGLARDAQIIESAALLRemlslpygaCPIPLLLDPTQTAAAWLMAhlkgs------grpceLTTHGNd-rLPYQ- 3207 fruit fly
XP_002003478        3194 IW-EsQGLARDAQIIESAALLRemlalpfgsCPVPLLLDPTQTAGQWLSAhlratgrasE------LTSQGNe-rLCYQ- 3264 Drosop...
WGS:AAQB:GK18215-PB 3192 IW-EsQGLARDAQIIESAALLKqilelpfgsCPVPLILDPSQRVTTWLMVylksenracE------LSSHGNe-rLAYQ- 3262 Drosop...
Q17MZ4              3008 IWeS-MGLTADQQYQENAIMLNkflllpfgtTPVPLLIDPTELGQKWLTNylnls------trtyeLTNQSAd-rFSYI- 3078 yellow...
Q7PMJ6              3034 IWeS-MGLTADQQYRENAAMVVkflslsyfsTPTPLLIDPSEYGQQWLTNyltyl------nrtyeLTSQGAd-rFAFS- 3104 Anophe...
18_pfamImport          2 HWnS-EGLPNDELSRENGIITIy-------tKISPLIFDPSSIAVTWLREhfkn--------dnmeIIAEHNp-kFYNV- 63  
EEB14047            3161 KWiS-EGLSSDQLSFENAVIMLe-------sWFHPLLIDPSGVALNWLKNhfss--------nnleIISQRHt-kLQTT- 3222 human ...
XP_002604212        4063 QL-ElQGLPTNPVALDSSCFVTetl----snNSWVLLCDPTSRAIPWLTDy-------lKeg--fiISKYHD----LKSq 4124 Florid...
4AI6_B              2043 LENAIRFGSVVIIQDGEFF----DPIISRLISReFNH---AgnrVTVEI--------GDhE-VDV-SGDFKLFIHSCDPS 2105 Schist...
Q170I1               427 LDEE------RILSQVEEFaqshQHIIAVNLREaNINhf-----sqLQTyhktyhsnKS-GtKQYaSA---LVVITTEEI 491  yellow...
Q0E8P6              3208 LELAVRFGKTLLVTDCEQL----RPPVLQLLQGhVFV---RfnkRQLAI--------GS-KlVDL-HESFQLVLISKSHR 3270 fruit fly
XP_002003478        3265 LELAVRFGKTLLVLDCEQL----RPPLLELLQLhIYVr-fNk--RQLAV--------GN-KlVDL-HEDFQLVLISKSHR 3327 Drosop...
WGS:AAQB:GK18215-PB 3263 LELAVRFGKILLVTDCDQL----RPPLAQLIQGhIYMk-fNk--RQMAV--------GS-KlIDL-HENFQLVLISKSQR 3325 Drosop...
Q17MZ4              3079 LELAIRFGKILIIRNVNAI----ETPLLSLVFTrIHS---RfnkRMVQI--------GN-KlIDL-HDDFKLILVTQNDK 3141 yellow...
Q7PMJ6              3105 LELAVRFGKVLIVKNVNAI----QAPLLSLFCTaIQS---HfnkKLLHV--------GN-KtVDL-HDEFKLILITQNET 3167 Anophe...
18_pfamImport         64 LEMAVRFGKTLIVEDMQTL----NPVLMPVLKQnFIY---QgprVTVHI--------GH-KlVDY-NSDFKIFLATRDMS 126 
EEB14047            3223 VELAVRFGKTLIIEEVEDV----HAVLIPLLRKdIIY---QgprQIIYV--------GE-KpVDY-NKSFKLFLVTRNTE 3285 human ...
XP_002604212        4125 LETCLTEGLFLILTDIDLHllakDNRFNHVFRRrMSFltgKa-pFKIIV--------GS-HeVEC-RPGFRLYMHTTCM- 4192 Florid...
4AI6_B              2106 GD-IPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNS-QGNMLEN 2183 Schist...
Q170I1               492 PY--HNKLKKTANVINFILDKSGLEVKLLVTIIKHENPSLEERKEALEQMIISSNETITNLEENILHILNHSqLP-LIEN 568  yellow...
Q0E8P6              3271 LD-LPEEQRSQLNVLKFTVTAAGLADQLMSKAIVLKNGELEQQRIELLQKEGHLLKQRMEMQDKLLEQLSKS-EGDILKN 3348 fruit fly
XP_002003478        3328 LQlLPPEQRGQVNLLRFTVTATGLADQLMSKAIVLKNPALEQQRIELLQREGELLKQRMALQDKLLEQLSKA-EGDILRN 3406 Drosop...
WGS:AAQB:GK18215-PB 3326 LA-LPKELASQVNQLRFTITAAGLTDQLMSQAIVLKNPKLEQQRIDVLQREGDLLKQRMELQDKLLEQLSKS-EGDILKN 3403 Drosop...
Q17MZ4              3142 LN-LGPELQANFMNLMFTTTVSGLSDVLKFKWVLAKDPEIEKKRVELLQEEGRLTKEKRSLQDRLLQELSSS-QGDILKN 3219 yellow...
Q7PMJ6              3168 LA-LDEELSAQLMTLRFTTTTAGLTDVLTYRWVQTKQPEIERKRTELLQEEGKLMKEKLNLQDKLLQELSSA-QGDILKN 3245 Anophe...
18_pfamImport        127 LI-RLYKMRTPFPTLNFDSTEEGLTQQLLGIALKVEKPKLEERRVELLNEEEKLKSKLHFLQEKVLIELANS-QGDILQN 204 
EEB14047            3286 IQ-THTDA----TTISFTVTEQGLAGQLLGLAVELERPELGMRRRELLKKEEEMKLKLYNFQENLLEQLASA-QGDILAN 3359 human ...
XP_002604212        4193 PHeVPEEVAAYTSLVNFYQDRSGIEAELLDRFIRLEKTRVQDERTNLAQEKIGNMERLALLEDQMLNLL--------ASD 4264 Florid...
4AI6_B              2184 DELMVTLNNLKKEA 2197 Schistosoma japonicum
Q170I1               569 EELYGTLQVSKQTA 582  yellow fever mosquito
Q0E8P6              3349 EQLLESLNEIKQGS 3362 fruit fly
XP_002003478        3407 EPLLASLNEVKRSS 3420 Drosophila mojavensis
WGS:AAQB:GK18215-PB 3404 EILLATLNEVKESS 3417 Drosophila willistoni
Q17MZ4              3220 EPLLNTLNSIKASA 3233 yellow fever mosquito
Q7PMJ6              3246 EPLLNTLNSIKGSA 3259 Anopheles gambiae str. PEST
18_pfamImport        205 KELLSSLTETKESS 218 
EEB14047            3360 KELVNSLNETKTSS 3373 human body louse
XP_002604212        4265 TRLLNNLAVTKKLA 4278 Florida lancelet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap