Conserved Protein Domain Family
AAA_8

?
pfam12780: AAA_8 
P-loop containing dynein motor region D4
The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D4 ATP-binding region of the motor.
Statistics
?
PSSM-Id: 403858
View PSSM: pfam12780
Aligned: 22 rows
Threshold Bit Score: 322.239
Threshold Setting Gi: 1229884158
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBJ26589     2386 MSLVFFPDAVRHLLRISRILRQPRGNAMLIGLAGSGRESLVHLATSMAGSTLVRVNVTHDYGIQKFEQDLKNAVLTAGID 2465 Ectocarpus si...
XP_009028868 1021 INLVVFKFVIEHVARLTRVLVQPGGHVLLVGLGGSGKHSLTRLATHMMDFDIYEIEMTRGYSSVEWHEDLKSMFRKTGLN 1100 Helobdella ro...
XP_008185063 1719 LSMVMFKFAIEHVSRVSRVLQQDNGHVLLVGIGGSGRQSATKLATFIADYKIFQIEIGRNYGKNEWNEDMKKILRYAGCE 1798 pea aphid
EFN89651     2249 IDITLFRYALQHLARICRVLAIPCGNLLMVGTGGSGRQSLTRLSSAIAGYGLRQPEITGTYGMQEWREDVKWVLKNSGGV 2328 Jerdon's jump...
EFA11266     2015 IDLVLFDHALEHLSKICRILSIPYCNLIQVGMCGTGRQTLVKLACLIMNQNFFKIEITEKYKLDDWHRTVKAFLKEAGGY 2094 red flour beetle
KOX75896     2119 IDIVISQYILECLIKISRILIIPGSNLLIISSMGSGRKSIASLAAYIQQQELFEPSVQSYCDFNMWRKDIKMVLRKCGEL 2198 Melipona quad...
KPI96079     1329 MRLVVFSEMAEHVTRVARVLRAERGHALLVGPAGSGRRSVAALAAHLNDCRCMGMELKRNYDVPEFHEDLVKMYMSAGVA 1408 Asian swallow...
ETV70813     2520 LTLIFFRDTIMHVSSMARILMQPRGNAMLIGVGGSGKRSLAKLAASIMSHDCFEIELTRQYGRSEFREDLKTLLVKTGVK 2599 Aphanomyces a...
EAY20602     2304 LDLCLFSEAIQHLCRICRIIREPGRNGLLLGVGGSGRQSLTRLAAYICGVQLFQPEVSRSYSRVEWRQDLKRLLLDCGLQ 2383 Trichomonas v...
Q23DD7       2716 MNLVLFSHTIQHITRMARVLHQERGHFMSVAVGGSGKKSLSILSALLTEMPYSQIMLKQNYGMKDFHDLLLKTMKEVAFK 2795 Tetrahymena t...
CBJ26589     2466 TKHTVFLLKDAQILDEAMLEDINCLLGSGEVPNLFTPDEEADIVIRVRDAVRAT----GKPDT-RARSMAFFTAQVRDHL 2540 Ectocarpus si...
XP_009028868 1101 DMPGVFLFSDSQLKQEVFLEEICNILNSGEVPNLFASDEKAEICEKMRKIDRMQdrskQTDGS-FLALFNMFTRKCRNLL 1179 Helobdella ro...
XP_008185063 1799 GNPITFFLSDNQIAEESFVEDINMLLNTGDIPNLYQSDERVDILDKISNIAQSLe--kNIETT-PLALYNFFIERVKENL 1875 pea aphid
EFN89651     2329 GKDFVFLLAEEQIRDDAFLDDVDSLLNDGEVPNIFNIEERQEIIEMTR--LAAQggdrNLDIS-VLNVLAFFVGRCREKL 2405 Jerdon's jump...
EFA11266     2095 GRPCTFFLKEGQIVIDTILDDLNYLLKSGEIPFIYSLEEKQELLDVVR--ASMQeeqpNIDES-SESIFLYHQKRCKENL 2171 red flour beetle
KOX75896     2199 RQDFILFLKDKQV-KHNFLQDICCLLATGEISDLFSAEEKCNIIETIR--LHAQngnkNEEIS-NDAVMNFFLEQCRNKL 2274 Melipona quad...
KPI96079     1409 LRETVFLCTDSQLSRDDFLEDVNNMLNTGEVNNLLEGDAYEQMQSGCGQDAAKA----GVNLSdRDALYRFFINRVRAKL 1484 Asian swallow...
ETV70813     2600 GKDTMFLLTDTQLISDEFVEDINALLNAGEIPHLFTHEEFEAVVNDMKPVLAQL----SIEDT-RQHAETTFVQRIRSHL 2674 Aphanomyces a...
EAY20602     2384 KKETVFLVSESQLIDESFFEDINCLLNSGDPPALFDDDDMEKIITGTTPLAKTL----GIVAT-RASVYSLFISQVKSHM 2458 Trichomonas v...
Q23DD7       2796 NQNQILLIMDNQIVKEQFLEEINNIMNSGEVPGIITKEELEIIEDNLKSDAKQQ-------DS-KLQAYDLFVQRVRNKL 2867 Tetrahymena t...
CBJ26589     2541 HIILCLDPSGATFRERIRNFPSLVNCSTIDWYNAWPKTALHSVAHRVLTElALVPSGPHEcgvgpklaaALIRTSVEVHG 2620 Ectocarpus si...
XP_009028868 1180 HVVMTMSPVGAVFRDRLRKFPALVNCCTIDWYHEWPNDALQAVATKFLTK-LELPRTLIE---------GCTHTCQTFQI 1249 Helobdella ro...
XP_008185063 1876 HLTLAMSPIGDVFRNRLRMFPSLINCCTIDWFTVWPEDALEKVAEYYLKD-MSINSDIAS---------SCVVICKEFHT 1945 pea aphid
EFN89651     2406 HIMLCLSPIGDAFRIRLRMHPGLVNCCTIDWFDVWPEDALEQVARRTLVD-LELAENVKD---------ESVVACKFFHS 2475 Jerdon's jump...
EFA11266     2172 HIIFSFNSANSKFRDYIKQYSSLRKFCEINYLKKWPKEALESIAKVWIQD-LNINDETKS---------KVVNAFSYFHQ 2241 red flour beetle
KOX75896     2275 HIIFCFRDVNKNIRSYLYKYPELIKYCTINWYEMWPTDTFLQVGLKYIED-INIEENVKI---------NVIKVCIQLHN 2344 Melipona quad...
KPI96079     1485 HLCICMSPVGEGFRRRCRMFPSLVNCCTIDWLTKWPPGALHSVARQSLVP--LADAKLIN---------DVSTVCVSMHQ 1553 Asian swallow...
ETV70813     2675 HIVLCMSPVGATFRRWCRQFPSLINCTTMDWYDEWPTTALMCVAESYLVDvVLAAEASRR---------ALAHMFVQVHL 2745 Aphanomyces a...
EAY20602     2459 HVMIALSPIGSSFRRRVRMFPSLISCCTIDWFAEWPIEALENVSTRVIGP-------------------EYSKFCASAHS 2519 Trichomonas v...
Q23DD7       2868 HVVLGMSPVGESFRNRIRMFPSLTNCCTIDWFQPWPEEALLQVATSFLEKeSSLTKLSKQ---------ILAKCFVFTHQ 2938 Tetrahymena t...
CBJ26589     2621 GVEPAAASFFSQLGRRIYVSPKSFLDFLRTFLNI 2654 Ectocarpus siliculosus
XP_009028868 1250 TSKMLATKFFEERGRITYITPMSYLELISTFKSI 1283 Helobdella robusta
XP_008185063 1946 TARDASVRFYSALKRHNYVTPTSYLELIKTFKNL 1979 pea aphid
EFN89651     2476 CTKDVSARFYELTGKKTYVTTASFLDLMRMFADL 2509 Jerdon's jumping ant
EFA11266     2242 EGEQI--------SNGVHVTPGSYLEFIRLYVDL 2267 red flour beetle
KOX75896     2345 HMQKISTEYYKESNTKIHVTLTAYLHMLKLYVYL 2378 Melipona quadrifasciata
KPI96079     1554 DVDVMSERLFTELRRHFYSTPSSYLDLLQLYLSL 1587 Asian swallowtail
ETV70813     2746 SIHRHTLLFHQVFQRHVYITPKTYLDSIRLYLRM 2779 Aphanomyces astaci
EAY20602     2520 IVSNYCQKFFEEMKRTNYVTPSTFLSFLNLITSL 2553 Trichomonas vaginalis G3
Q23DD7       2939 VITQSIEDFYNVWKRKVYSTPKNYIQMIMNYRNL 2972 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap