Conserved Protein Domain Family
AAA_7

?
pfam12775: AAA_7 
P-loop containing dynein motor region D3
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D3 and is an ATP binding site.
Statistics
?
PSSM-Id: 403854
View PSSM: pfam12775
Aligned: 321 rows
Threshold Bit Score: 125.605
Threshold Setting Gi: 154413665
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGR31445     2104 EEI-PAKKKPSEILVQTSDTVRYSFLLRHNISEEIPTLYCGPTGTGKSIYVKNiLMNDLP-RSQYMTIEVGFSAQTSANA 2181 Ichthyophthir...
KEP65299     2378 FSY-DPSQPFFSLLVPTKEFARATFLLDKMIEAKKSIFLTGAISSGKTTVMTHlLDEKRE-AGTLHTIRMCFCARTKADE 2455 Hammondia ham...
XP_001327049 2051 ISI-TANKPIEQQLIPTNESAAMTYISRLTVQHGIHTLFHGPE-SSKSLVINT-LMQNIL-DKSFDCRNLPLANCSTTQN 2126 Trichomonas v...
EAY20056     2033 MEA-SKNHPVESTFIPTQESATMIFLARLLVEHQKHVLFHGPE-SSKTMVVKN-LFENVL-PQKYDCRHLPIANCSTASN 2108 Trichomonas v...
EAY21562     2063 MNF-TDQENLDHQVVPTNEIASTFFLSRLLVANYKNTLIQGPE-SGKSLIMNTlQTKFFN-KQPYITGKFDCSAITTPKM 2139 Trichomonas v...
EAY21612     2033 INL-TQNLPIEKQFYPTNQNAAPLFFSRLLLSNHHSVLLQGPE-SSKTLIGKTlIGSVLD-PAKFPSYVLPLAPSTQPSN 2109 Trichomonas v...
XP_001326879 1146 VGL-TSDLPIEQQLISTKESAVTIFLSRLLCSNGYHVLLQGPE-TSKTLSVKTlFSKVLE-PTKYDCHIFPLASCSTPTG 1222 Trichomonas v...
EAY07015     2044 LPI-NPTVPIEQQFVPTNESVAPQYITRILSAHHKHTLLIGPE-SSKSLLVKT-TFSNLP--EKYDKHVIPMSNCVEAKE 2118 Trichomonas v...
XP_005824575 2374 WNY-QK-LVLQELFVPSIETVRSDYLLKFLSTKKMNVLITGTPGCGKSTLMQR-YLSSHD-SDKFIWSYMSLCPSSTVES 2449 Guillardia th...
XP_001579862 1937 FTIhPQSIMANSIMIPTVETERVNRLFKLYLESGLNILLRGPPGSGKTTIKRN-FTRNLEdERKLQIMDVECTKSFPPSE 2015 Trichomonas v...
EGR31445     2182 TMDIIDKKLDRKKK-GVFGPKTGK-CVIFVDDLNMPTKEKWGAQPPIEILRQMMDQGG-WYDLQDkdK-PFKELVDIIFV 2257 Ichthyophthir...
KEP65299     2456 VQQTIELKLEKKRK-NQLSPPAGReCVLFVDDVNLPLPEKTGAQPAIEFLRQIQEFKG-FYDSKK--I-HWNVLEKCLLL 2530 Hammondia ham...
XP_001327049 2127 VLKTLRSFMHKHH--GVFGPLTNMqLVIFLDNINSVKPEIYGAQPPLELIRQMLDAGG-WYNTAQ--I-EFQRVADTTLI 2200 Trichomonas v...
EAY20056     2109 ILKVMRSFMHKHH--GVFGPLTNQqLVIFLDNIGAVKPEIYGAQPPLELIRQLCDYGG-WYNTSN--V-EFQNVVDTTLI 2182 Trichomonas v...
EAY21562     2140 FMDFTSQYMHKQQ--GIYGPLPGDkLVFFIDNLASIEPDGFLTQPAIELMRELVTYGG-WHYTS-----EFSELIGYTLL 2211 Trichomonas v...
EAY21612     2110 ISKFMLQFMHKKL--GTFGPLPGQhFLFLIDNLGSVKPEIYGAQPALELLRQFFDHGG-WFNTSP--V-EFLNIIGTSIL 2183 Trichomonas v...
XP_001326879 1223 ISKFLQAYMHKRQ--GKLGPLPNQqLIYLLDNFNSVKPEVYGAQPPLELIRQFMDYNG-WYQTSP--V-EFQSITGTSLI 1296 Trichomonas v...
EAY07015     2119 LYTDIKSLLQKRH--GAYGPLPGQsLLVFLDNIGTPKPELYGAQPPLEFIRQIIDYGG-WYDTKK--V-EFENVAETTFI 2192 Trichomonas v...
XP_005824575 2450 LLESLHFIIEKKQG-RTYLPENGKaCTVFVDDISLTPVDPWGEQKLCELLRQLMIDNG-YYSHEL--PsEWRTLIGINYL 2525 Guillardia th...
XP_001579862 2016 LMKFMHRCMGLKKKsILYGSGAVKrCLV-LDDIHNLEENDFGEKPIIEFLRQISEQNGsFFTPKN----MWTTIEDLVLL 2090 Trichomonas v...
EGR31445     2258 SAMGPPGGGRTFITARFLRHMNLITLVNF 2286 Ichthyophthirius multifiliis
KEP65299     2531 LGGAPPSSGRKPLPPRFCRHSLSLRLAEP 2559 Hammondia hammondi
XP_001327049 2201 SAMGPEGGGLFSIPQRLLRHFYFMHIPKY 2229 Trichomonas vaginalis G3
EAY20056     2183 ACMGPAGSGLFNIPERLMRHFNIIHAPKT 2211 Trichomonas vaginalis G3
EAY21562     2212 ISTQMKGSGRYAISPRFIRNFFYIYQPKY 2240 Trichomonas vaginalis G3
EAY21612     2184 ATTGVAGGGMYGLPHRLTRHFFTIHLPKY 2212 Trichomonas vaginalis G3
XP_001326879 1297 ATMGVPGGGLYTVPERLLSHFFILHCPPY 1325 Trichomonas vaginalis G3
EAY07015     2193 SAMEMPVGHSFNIPERLLRHFVSLHIPKT 2221 Trichomonas vaginalis G3
XP_005824575 2526 AAMSHPAHTQKDISVRMKAQFVAMSLGST 2554 Guillardia theta CCMP2712
XP_001579862 2091 GVGNDDSSTHKNLNARFTKTAITYQLSIN 2119 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap