5ME3


Conserved Protein Domain Family
Cohesin_HEAT

?
pfam12765: Cohesin_HEAT 
Click on image for an interactive view with Cn3D
HEAT repeat associated with sister chromatid cohesion
This HEAT repeat is found most frequently in sister chromatid cohesion proteins such as Nipped-B. HEAT repeats are found tandemly repeated in many proteins, and they appear to serve as flexible scaffolding on which other components can assemble.
Statistics
?
PSSM-Id: 403845
View PSSM: pfam12765
Aligned: 41 rows
Threshold Bit Score: 31.6614
Threshold Setting Gi: 257167662
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ME3_A           331 RCLALLISKDKNMLYTPIVKETIENRLTDSSPLVKDAILELI 372  Eremothecium gossypii ATCC 10895
Q6CGZ4           756 KSLTTLLSYDPKIMRLPFVANSLKSRLVDASASVRDAAVEIV 797  Yarrowia lipolytica
jgi:OSTLU_30206  714 RAIGGIVNEDPKLLESPDIVRALKIRLKDTGSSVRAAVVDVI 755  Ostreococcus lucimarinus CCE9901
EEH59709         680 RAIDNVVSADHRILGVEQIRSAIERRMTDSGTMVRSSIVDLL 721  Micromonas pusilla CCMP1545
XP_002185061     745 VFSLQVADGDPQLMLLPIVTKAVSRRLTDDSISVREATVSLV 786  Phaeodactylum tricornutum CCAP 1055/1
Q5KNU5          1145 RGVGSIVMVDPDVLRLRQFRLALEERLSDVSPGVRDAAVELV 1186 Cryptococcus neoformans
A5HEI1           895 RAVSIIVEADPEVLCDKRVQLAVEGRFCDSAISVREAALELV 936  thale cress
XP_002408225    1098 KCLTLVVEADPSILGRPDMRQGVHGRLLDHSTSVREAAVDLV 1139 black-legged tick
Q54RK7          1161 KSFTTIVEADPSILADEKVHSAIKNRFLDESILVREHTVDLI 1202 Dictyostelium discoideum AX4
XP_002114243     812 KCLTSIIGEDPNILRRKEVHQAVHARLLDTSVSVREAAVELT 853  Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap