Conserved Protein Domain Family
Vac7

?
pfam12751: Vac7 
Vacuolar segregation subunit 7
Vac7 is localized at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway. The Fab1 lipid p[pathway is important for correct regulation of membrane trafficking events.
Statistics
?
PSSM-Id: 403835
View PSSM: pfam12751
Aligned: 33 rows
Threshold Bit Score: 388.988
Threshold Setting Gi: 549055715
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPE07881     392 TVETETVTSIPNVALGP-SAAQGVNGSLRTKPSSETIR-PKKEKKKTTRKQTPv-TPGA--TTSKADIFEAKVASAVD-- 464  Ophiostoma pic...
CCX05507     295 TVETETVSSVPQVGLGN-VGPAG-TTSLRSKKSTDTIKaPRRERKRTLKKSSAmgPSNLrpASSKADIFAAKVADAIDeh 372  Pyronema ompha...
XP_012743371 338 TVETETVSSIPQVAVGGgTGTV--NGSLRTKPSSETIR-PKKEKRKTTRKPQSv-QNGV--ASSKADIFEAKIASAVD-- 409  Pseudogymnoasc...
EQB58164      84 IVETETVSSIPQVALAPaAKLEPGTGTLRAKPSTETIR-PKKEKKKTSRKQPTv-NPGN--ASSKADIFEAKVASAVD-- 157  Colletotrichum...
XP_007819244 334 TVETETVSSIPQVALTTaTK-EGGNATLKAKPSTETIK-PKKEKKRTARKQPAv-SAGT--ASSKADNFEAKIASAVD-- 406  Metarhizium ro...
XP_013937827 299 TVETETVSSIPQVALTVgPKADGMNGTLRTKQSTETIK-PKKEKKRS-RKQPv--TSGN--GSSKADIFEAKIANAVD-- 370  Trichoderma at...
XP_006665550 327 TVETETVASIPQVPINTsSKADGPNGTLKTKHSTETIK-PKKEKKKTVRKQSNv-HTGT--SASKADNFEAKIASAVD-- 400  Cordyceps mili...
EEU45157     323 TVETETVPSVPQVALATgPKSEGPNGTLKTKQSTETIK-PKKEKKKTTRKQPAv-NTGN--ASSKADIFEASIASAVD-- 396  [Nectria] haem...
CCU77868     265 TVETQTVSSIPQIAVCSgGSGN--GGSIRTKQSNETIR-PRKDKKKATRKLPSv-TAGT--ASSKADIFEAKVASAVD-- 336  Blumeria grami...
XP_001593574 339 TVETETVSSIPQIALATgAGGLGANGSLRAKQSTETIR-PRRDKKK-SRKAPSv-ASGT--ASSKADIFEAKVASAVD-- 411  Sclerotinia sc...
EPE07881     465 -EANTSDSEETFVYDSNPADG----RDRPhRFHHSRTPSATSLSQA--DR---SGmRS-IHSIMEgggPSgGVTVKKSMK 533  Ophiostoma pic...
CCX05507     373 rENDSDDSAETFVYESNPADSthtlHHRPsTRFHSRTPSATSI--GpdHR----GqRLpLIDNMG----GaNSTGRKGMK 442  Pyronema ompha...
XP_012743371 410 -EANSSDSEETFVYESNPPD-----HERP-RRFHSRSPSTTSMASQs-QAdlrPGpPSrLANTLDg-sNGhSVAMKKSMK 480  Pseudogymnoasc...
EQB58164     158 -EANTSDSEETFVYDSNPPDV-------ErRRYHSRTPSATSMISQa-DRagaLGmRS-IHEALQ---VNtAAGLKKSMK 224  Colletotrichum...
XP_007819244 407 -EANTSDSEETFVYDSNPPDN----TERTnRRFHSRTPSATSMASQv-DR---QNlRS-IYGIMEg--TShGPVAKKSMK 474  Metarhizium ro...
XP_013937827 371 -EANTSDSEETFVYDSNPPDV----GDRAtRRFHSRTPSATSIVSQg-DR---PNlRS-IYGIMD----NhVPAPKKSMK 436  Trichoderma at...
XP_006665550 401 -EANTSDSEETFVYDSNPPDG----TDRTvRRFHSRTPSATSMASQppDR---QNvRS-IYGVMEa-aGHhGPVPKKSMK 470  Cordyceps mili...
EEU45157     397 -EANTSDSEETFVYDSNPPDG----NDRAgRRFHSRTPSATSMASQa-DR---QNlRS-IYGIMEg--PGpAHGPKKTMK 464  [Nectria] haem...
CCU77868     337 -EANSSDSEETFVYESNPPDV----NDRP-RRFHSRTPSAASMVSQidQR---CGvRA----IME---SHqSVIMKKSMK 400  Blumeria grami...
XP_001593574 412 -EANSSDSEETFVYESNPPE-----QERP-RRFHSRTPSATSMASQidAR---NGlRS----MMDn--GShSVAMKKSMK 475  Sclerotinia sc...
EPE07881     534 FVNTfGNTsSNDSGM-GDDETNKaatiRGVT-GS---GrGTARlhH--HV-GRFGLgggaKNGHQSILDHESPFPVSTas 605  Ophiostoma pic...
CCX05507     443 FVN---NNkDLGGDGvSSDHNG---------------GaGSSR---------EHGGgrrhHNGHRSLLS-EDPFNRAAhr 494  Pyronema ompha...
XP_012743371 481 FASSf-APlPPTSDAaTDDDAAQ----RALGt-----GrGTIRh-H--HI-GRWGRnn-nTSSHGSLFDAESPFPHATkp 545  Pseudogymnoasc...
EQB58164     225 FVNTf-NSnGAESLG-ADDDGKGs--gRSAGvGS---GrGTGRhhHhnHF-GRWGRh--pGNTHPSLFDNESLFPNAArs 294  Colletotrichum...
XP_007819244 475 FVNTf-NGnASDSLTpGDEDGKGs--gRSAG-GS---ArGTVRhhH--HI-GRWGRq--pGNGHASLFDTESPFPNAAks 542  Metarhizium ro...
XP_013937827 437 FSNTyGNGaIDGGVLtGDEDGRGt--gRSAG-GS---GrGTVRqhH--HI-GRWGRq--pGNGHASLFDNESPFQNTPrp 505  Trichoderma at...
XP_006665550 471 FVNTf-NGsGTESLTpGEDDGKAt--gRSAG-GS---GrGTARhhH--HI-GRWGRq--pNNSHLSIFDNDSPFANTTra 538  Cordyceps mili...
EEU45157     465 FVNTf-TSnGNDNLTvGDEDKASn---RGGGsGS---TrGTARhhH--HI-GRWGRq--pGNGHPSLFDNESPFPNAArt 532  [Nectria] haem...
CCU77868     401 FANSy----ATNGTDpLISDEAV----KGTIrGSngiGrGTTQh-H--HLnTRWGRn--iGNSYYQTIDNESPLLHAAts 467  Blumeria grami...
XP_001593574 476 FANSsYNSaPQEMSTeDDGKGTS----RSNL------GrGTAh--H--HF-SRWGRn--gGNGHASLFDNESPFPNAAks 538  Sclerotinia sc...
EPE07881     606 rlkmlsggsgggvssggptsypsgrtGGPTSPRASGGSmsGRSGGTYSQKRGYGSTGghhfgYDMDdttPGQAgSDERTP 685  Ophiostoma pic...
CCX05507     495 sttslrna--------assfissrqsSRPPSPKLNAFR----NGNTPGGKRSPRTRV-----YEAD---VENG-DDEHTP 553  Pyronema ompha...
XP_012743371 546 skfgn--------------sasmrqsSRPTSPRVGANG--RGVNGNGTVRKGGFAHA-----YDIDd--GAGA-DDERTP 601  Pseudogymnoasc...
EQB58164     295 kmsa----------------nnsrqsSGPPSPRVASSA---RGGPHALGKRSSIQMAr----YDADdttTTGA-DDERTP 350  Colletotrichum...
XP_007819244 543 kfsssn------------nlnnsrntSNLSSPRTFLS-----TRGHLNPKRSTMQMSs---sYDLDd--TTGA-DDERTP 599  Metarhizium ro...
XP_013937827 506 kia------------------nsrhsSGPPSPRNHPS-----MRGPLSSKRSAIHMSs---sYDLDd--TTGA-DDERTP 556  Trichoderma at...
XP_006665550 539 kppt----------------sasrnsSGPTSPRNHHS-----PRGQLSSKRSALQMSs---iYDMDe--NTGA-DDERTP 591  Cordyceps mili...
EEU45157     533 klag----------------ansrnsSGPPSPRNAHS------NRNFGHKRSAMQMSs---nYDMDd--TTGA-DDERTP 584  [Nectria] haem...
CCU77868     468 nppr----------------isprtlSRPTSPRISIS-------RLTNNKKKSTPGTl---rCDLQd-----SvSNERTP 516  Blumeria grami...
XP_001593574 539 kfsa----------------hpsrqgSRPTSPRVVNSA----RMSNANGKRTSPISSg----YDLDd-----AaDDERTP 589  Sclerotinia sc...
EPE07881     686 LMgtASLRgTVRGNNrtsRRHH--MSLRALEQQsyhhHPPASFLNRFASCLVLTVMLMLVISGAIGFMFATSQPLDDIEL 763  Ophiostoma pic...
CCX05507     554 LM-------VPRSRRr--AGRPpnGSLRQMEYn----ARRRGWIRTYAGCIVAIVAIILILTGVGGFLIATTNALQGVKV 620  Pyronema ompha...
XP_012743371 602 LIgsGT-R-STRSRH---RRNPptSS------Q----QRQRNSRSPFGACLILGVMAVLVFSGALALLLGTAQPLGGVRI 666  Pseudogymnoasc...
EQB58164     351 LLt-STVR-SARRTR----RHP--ANLRNLESQs--yRQQPSYLNRFAACLVVTMMLLLVITGAIGFMFATSQPLTDIEL 420  Colletotrichum...
XP_007819244 600 LL--GTVR-SSRGGR----RRP--HTLRQAESQt--yTRRSSYLNRFAACLVLTMMLLLVITGAIGFMFATSQPMTDIEI 668  Metarhizium ro...
XP_013937827 557 LL--DNGR---RGGRf--RRGP--HNLRQAEAQt--yTRRSSYLNRFAACLVLTMMFLLVITGAIGFMFATSQPLSDIEI 625  Trichoderma at...
XP_006665550 592 LI--GTAR--YRSGRn--RRGP--HNLRQAESQt--yTRRSSYLNRFAACLVLTMMFLLVITGAIGFMFATSQPMAGIEI 661  Cordyceps mili...
EEU45157     585 LI--GSIR-SGRSQRn--RRGP--HNLRQAESQt--fTRRSSYLNRFAACLVLTMMFMLVITGAIGFMFATSQPMTGIEI 655  [Nectria] haem...
CCU77868     517 LI--PAAR-KNKAFRs--RRYN--TSLRQLEHQa--tRRSQTFLSRYGGCLFLILFVLLVILGAIGFMYATTQPLVNLKV 587  Blumeria grami...
XP_001593574 590 LIp-STIR-SARSSR---IRRGnaPSSRHIEHQ----RQSRSFFARFAGCMFLSLLILLVVAGAVVFLFATTQPLANVKV 660  Sclerotinia sc...
EPE07881     764 VKISNVIASEQELMFDLMVRAHNPNVVVVTVDSADMEVFAKSPHAGTDS 812  Ophiostoma piceae UAMH 11346
CCX05507     621 LNVTDVLVSKQEIMLDLVVEAMNPNAIAVTVGSMDVNIFAKSSHVrdga 669  Pyronema omphalodes CBS 100304
XP_012743371 667 AALRDVLASKTELLLDVDVVARNPNVFAVGVDKLDISVYAKSRYAGDEA 715  Pseudogymnoascus destructans 20631-21
EQB58164     421 VSIKNVLASDPELMFDLTVKAHNPNIVVVSIDQANLEIFAKSPHAGTDF 469  Colletotrichum gloeosporioides Cg-14
XP_007819244 669 MSIKNVVTSEQVLMFDLTVKAHNPNIVVVTIDHANLEIFAKSEYAGNDS 717  Metarhizium robertsii ARSEF 23
XP_013937827 626 VSIHNVVTSEQVLMFDVTVKAHNPNVVVVTIDHANLEIFAKSEYGGADS 674  Trichoderma atroviride IMI 206040
XP_006665550 662 VSIQNVVTSEQVLIFDLSVKAHNPNIVLVTVDHTDLEIFAKSDHGGTDS 710  Cordyceps militaris CM01
EEU45157     656 TAIHNVVTSEQVLMFDLTVKAHNPNIVVVTIDHANLEIFAKSEYTGTDS 704  [Nectria] haematococca mpVI 77-13-4
CCU77868     588 ISLKNIIASEQDLLFDIEARARNPNLVSVTIESTDIAVFALSKYSCCDl 636  Blumeria graminis f. sp. hordei DH14
XP_001593574 661 LALKNILASEQDVIIDLQVIAQNPNLVAVTIDSMDMVIFAKSKYAGTDS 709  Sclerotinia sclerotiorum 1980 UF-70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap