Conserved Protein Domain Family
Maff2

?
pfam12750: Maff2 
Maff2 family
This family of short membrane proteins are related to the protein Maff2. Maff2 lies just outside the direct repeats of a tetracycline resistance transposable element. This protein may contain transmembrane helices.
Statistics
?
PSSM-Id: 403834
View PSSM: pfam12750
Aligned: 6 rows
Threshold Bit Score: 99.4989
Threshold Setting Gi: 291166700
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:ADGE:HMPREF0389_00665.1  1 MEFFTQAVDVLKVLVMAVGAGLGAWGVINLMEGYGNDNPGAKSQGVKQLMAGGGIVLIGLKLIPLLANVL 70  Filifactor ...
CDC75988                     1 MAFITQAVTVLQTLVIALGAGLAVWGVVNLMEGYGNDNPGAKSQGIKQLMAGGGVVLIGTTLIPLLSTLF 70  Firmicutes ...
CBL26627                     1 MEFFNSAIDVLQTLVIALGAGLGIWGVINLLEGYGNDNPGAKSQGIKQLMAGGGVALIGTILVPLLSGLF 70  [Ruminococc...
CBL01620                    23 MEFFNSAVDTLQTIVVGLGGALCVWGGINLLEGYGQDNPGSKSQGVKQLVAGGGVALIGVTLVPLLSGLL 92  Faecalibact...
WP_014080814                 1 MQFFTSAIDTLQTLVVALGAGLGVWGVVNLLEGYGSDNPGSKSQGMKQLMAGGGIILLGTTLIPLLSGLF 70  Clostridiales
WGS:ADGE:HMPREF0389_00234.1 21 MAFFNQAISTLSVLVIAIGAGLGVWGAVNLLEGYGSDNPGAKSQGIKQLMSGGGIILIGVKLIPMLSGLF 90  Filifactor ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap