2OCF


Conserved Protein Domain Family
ESR1_C

?
pfam12743: ESR1_C 
Oestrogen-type nuclear receptor final C-terminal
This is the very C-terminal region of a subfamily of nuclear receptors that includes oestrogen receptors and other subfamily 3 group A members. The actual function of this region is not known, but the domain is absent from all the other types of nuclear receptors. Oestrogen receptors modulate AP-1-dependent transcription through two distinct mechanisms: via protein-protein interactions on DNA; and via non-genomic actions. The mechanism used depends on the cellular localization of the receptor. In addition to the more extensively studied cross-talk on DNA, additional non-genomic actions might be very important in target tissues in which membrane-associated ERs are found. These non-genomic actions probably contribute to the overall physiological responses mediated by ligand-bound ERs and might possibly be mediated via this C-terminal domain.
Statistics
?
PSSM-Id: 403830
View PSSM: pfam12743
Aligned: 17 rows
Threshold Bit Score: 54.0512
Threshold Setting Gi: 119600
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OCF_A        259 GGASVEETDQSHLATAGSTSSHSLQKYYI-TGEAEGFPATV 298 
ELK09328      586 GDTPMAETHQSHMAATAPTSSHSLQTYYI-SGEAESFPSTI 625  black flying fox
XP_003255939  556 GGAPMEETDQSHLATAGSTSSHSLQKYYI-TGEAEGFPATV 595  northern white-cheeked gibbon
XP_003769593  550 GGAPMEEDNQNQLATA-STSSHSLQTYYI-TRDEESFPTTI 588  Tasmanian devil
Q25C14        547 ATAQ-EEDSRSPLTTTANGASPCLQPFYT-STEEVSLQSTV 585  tropical clawed frog
Q91250        548 SAAPMEEENRSQLTTA-SASSHSLQSFYInSKEEENMQNTL 587  zebra finch
XP_012912196  558 GSAPMEEMSESQLATTGATSSHSLQAYYI-TEEAASFPSTV 597  domestic ferret
XP_028913283 1126 SNAPMEEETQNQLATA-STSSHSLQSYYI-TREDENFPTTI 1164 platypus
XP_012665573  558 MGVSPEEMGQSQLASTGSTSSHSLQKFYI-TGEAESFPATI 597  small-eared galago
AAK52104      392 GSTPPEDVNQSQLATTGCTSSHSLQTYYI-TGEAENFPSTV 431  sheep
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap