4MRU,3GZS


Conserved Protein Domain Family
SusD-like

?
pfam12741: SusD-like 
Click on image for an interactive view with Cn3D
Susd and RagB outer membrane lipoprotein
This is a family of SusD-like proteins, one member of which, BT1043, is an outer membrane lipoprotein involved in host glycan metabolism. The structures of this and SusD-homologs in the family are dominated by tetratrico peptide repeats that may facilitate association with outer membrane beta-barrel transporters required for glycan uptake. The structure of BT1043 complexed with N-acetyllactosamine reveals that recognition is mediated via hydrogen bonding interactions with the reducing end of beta-N-acetylglucosamine, suggesting a role in binding glycans liberated from the mucin polypeptide. Mammalian distal gut bacteria have an expanded capacity to utilize glycans. In the absence of dietary sources, some species rely on host-derived mucosal glycans. The ability of Bacteroides thetaiotaomicron, a prominent human gut symbiont, to forage host glycans contributes to both its ability to persist within an individual host and its ability to be transmitted naturally to new hosts at birth.
Statistics
?
PSSM-Id: 403828
View PSSM: pfam12741
Aligned: 30 rows
Threshold Bit Score: 593.461
Threshold Setting Gi: 332740687
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MRU_B         4 DXNRNKYEVDSEEIGRENYDLGSTIRGLQGLVIPAQE--------HLYQFXEAXCGGSYAGYFGETRTgWLE-K-YSTYN 73  Bacteroides the...
EGK05625      32 DMNRNPAQPTDKEILEGYYKLGAFFPQMLNYAYPAQE--------NAYQMGENLIGDPYGRYLSIANT-WSSn--FSTFN 100 Dysgonomonas mo...
WP_007575206  32 DANRPGNKTNAEELGRDNYMSGNFLINMQDNVFPEQE--------NAYQMNYDLIGNYLGRYFTYANNgFAQ-KnFVLSN 102 Prevotella mult...
WP_013265914  27 DINRPGSKLSPEELKRDNYAVGSFLIQMQGVAFPEQE--------NAYQTMIDFVGNYLGRYTTYTKE--LP-KnHILFN 95  Prevotella mela...
WP_027324136  27 EINTNKQGVTPEQAEGDGVASGGFIQTLQRSVVPVGTaanktdiiNVYQTAYHIGQDDWAGYFGQNAD-WEGsRnHTTYS 105 Bacteroides pyo...
3GZS_B         4 DINRNPLLPTKEDEKXDGVIYGAYLPNLEKSVIPIGTasestepvNRYQIGVNLAGDAWAGYXSPRDNkFNGsKnFTNYF 83  Bacteroides fra...
WP_009415283  23 EINTDAFGITSAMGKKDGITIGAKITSLQAQVVPVGTqadgtdvvNEYQIAYHLAADTWSGYFAQNQG-WNNgYnNTTYF 101 Capnocytophaga ...
CDA95156      26 EINTNPYEMTDEMGKMDGLSLGSYITTMERYVLPVGTqadrtdmiNEYQIAYHLSADCWSGYFGQDNN-WGGgNnNTTYY 104 Bacteroides sp....
EJU15931      27 DINTSRVGVTDEELNQGGLAYGLAMMSLQRSVMPIGVaget-gpgNSMQVLELISTGNYVGYYGNNNN-WNF-NtEGTWT 103 Porphyromonas s...
EGJ71169      21 DINSNIYGVTDSELKAGGLAYGSAFMKMQQLVIPIGSpdkttdpgNDLQNTDLISSGNYIGYFGNNNN-WGF-NiESNWN 98  Bacteroides cop...
4MRU_B        74 PKTDWLKAPFTDVISETYPKYYAVLQH---E-DAPV-----ALALAKLLRVTIXQRVTDIYGPIPYSKVLVsGEgsesdg 144 Bacteroides the...
EGK05625     101 APAGWINSPFKDAFEKVYGGWTQVKEQ---T-KGEGp----LFAWAQILRVTSMQRITDLYGPIPYSKVGG-GS------ 165 Dysgonomonas mo...
WP_007575206 103 APENWAAYPLRDMKPKIESNFEEIRRI---S-HGEGl----TYALALILRAQGYLTLTDMYGPL---TIGAdDN------ 165 Prevotella mult...
WP_013265914  96 ASNAWCAWP-ASYAPPMVSAFDEVVKL---N-GKKNi----SYAWALILRAQAFLRFTDIYGPFPLSMNAD--------- 157 Prevotella mela...
WP_027324136 106 LVNNWVKESYKQSYTQAFSPWLSIKNN---P-AAKLnp--eNFALAQVLKVAVWHKATDIFGPIPYTKAGE-GL------ 172 Bacteroides pyo...
3GZS_B        84 XYENWVNYVYSFXVTDVYSPWXQIKRI---S-QDEGtrndeIYALAQIIKIAALHRTTDXFGPIPYSQVGK-GS------ 152 Bacteroides fra...
WP_009415283 102 LLEGWYSASYNSSYTKVLPLWSSVKTN---A-ESSNfp--eAFALAQILKISAWHKATDMFGPIPYKEAGK-GL------ 168 Capnocytophaga ...
CDA95156     105 LNNGWLSATYKDSYTNVLPSWKKIKAT---S-EKLNap--eVFALAEILKISCWHKTLESFGPIPYTHAGE-MA------ 171 Bacteroides sp....
EJU15931     104 FTNGRMSILYGLLYGDVAKSWLPIHIQasrAkDNLQaq--qVLAMANIVKVVGWLRATDAFGPIVYTKAGS-GD------ 174 Porphyromonas s...
EGJ71169      99 FREDRMTYAYENFYSKLYRSWNDIYKEangS-EEPNdk--aTLALANIVKVAGWLRATDVFGPIVYTNAGK-GS------ 168 Bacteroides cop...
4MRU_B       145 LNAAYDSQKDVYXRXFQELEEADQALEDNXTEGNSGFE--KLDDVYYGKLQQWRLFLHSLQLRXAXRLCYTDxAAEAQSI 222 Bacteroides the...
EGK05625     166 LGSAYDSQEDVYKNMLADLDAAIAELTTFVAANPNYTAmaKFDKVYSGDFTKWIKYANSLKLRMAMRIVYAN-PELAKQK 244 Dysgonomonas mo...
WP_007575206 166 DANAYSSQKDVYKRILSDLDSATAMMAPVVSANPSVKFaeEYDHVYHGTLSSWLKFANSLKLRMAIRMRFVE-PGLAKKI 244 Prevotella mult...
WP_013265914 158 NTVVYTSQRDIYLQLIKDLNEATAYISSDTQLAKEMIVfaPYDLVYKGDFNKWRKFANSLKLRIAVRISNVE-PTLARSL 236 Prevotella mela...
WP_027324136 173 LNTPYDSQEVVYMSMLSDLEKAIETLTSFEEQGGKLFP--NYDLVYGGNTTNWVKFANSLMLRLAMRMRYVA-PAEAKRY 249 Bacteroides pyo...
3GZS_B       153 FKVAYDSQESVYRSFLKELEEAVQTLDDYSNKSKEVLP--AFDIVYNGDVNKWXRFANSLXLRLAIRVRFAD-AGLAKEY 229 Bacteroides fra...
WP_009415283 169 FRVPYDSQEEVYQAFFDDLTAAIAVLQNKVTQGGTLLA--DYDAVYAGNVTKWVKYANSLMLRLAMRIRFVD-PAKAQRY 245 Capnocytophaga ...
CDA95156     172 LVIPFDSEKDVYTAMFKDLKAAIEVLTPYAETNSTIVA--DYDAVYAGSARQWVKYANSLMLRLAMRIRYAD-EAMSKQW 248 Bacteroides sp....
EJU15931     175 ITPTPDSQQEVYKGMLADLEKSAAVLREARESVLS-----RNDLVYNGDASKWVKLANSLMLRMAVRVHFKD-AALAKEY 248 Porphyromonas s...
EGJ71169     169 IAPKLDSQEDVYRAMLADLDESVEILKNYPSLLMN-----DYDAIYDGNTSKWVKFANSLMLRMSVRVHFKD-QALAQEY 242 Bacteroides cop...
4MRU_B       223 AEKAVTA---GVIEKNDDNALFH-----VAENRSALCFNDWKDYRVGADIICYXNGYADPRRDKYFTKVKNN-------D 287 Bacteroides the...
EGK05625     245 AEEAVKHt-lGVIVSNNDIAQNA-----FPQNPIWTVTTSWGDSRACADIIAYLSGYSDPRLSRYFTKSQVA-------N 311 Dysgonomonas mo...
WP_007575206 245 GEQAVKD---GVITNNSDNLTIT-----YTPNGLYKTSVEWGDTRACADIETYMNGYHDPRIEKYFSSPATS-------G 309 Prevotella mult...
WP_013265914 237 AEQAVRD---GVIEGNEDNCAIR-----YNKSGLWTTAVSWGDSRICADIESYMTGYKDPRMSMYFLQPMTA-------G 301 Prevotella mela...
WP_027324136 250 AEMAVNHr-iGVMTVKEDGASISmahglQFENPIERTAGQYAETRMGTPAFSYMAGYEDPRLPKYFRTTKHPyavslpwA 328 Bacteroides pyo...
3GZS_B       230 AEKAVKHp-aGLINSKELAAQXGkgaglQXKNPLKVINEEYNDTRXGATIYSYLAGYNDARAAVYFV------------K 296 Bacteroides fra...
WP_009415283 246 AEQAINQp-lGVMTDKADEAKMQegaglSFINNIETFVNQYGECRMGSAMYSYLVGYEDPRLMAYFKPSTSPyaqnvpfA 324 Capnocytophaga ...
CDA95156     249 VGEALSQh-iGLMTAANDAAQMSkgagyVFVNNIQYLAESYEECRVATSVYAYLNGYHDPRLGKYMKPSPTYpsaltgfD 327 Bacteroides sp....
EJU15931     249 IAKALDAsngGVIETTADEAKIGnsdkqPLAHPALISVDQYNETRMGATIWSYLQGYNDPRLEKYFTKGTYR-------N 321 Porphyromonas s...
EGJ71169     243 IQKALDPangGVIENIEEEAKVQstskmPLLNSLLASID-YGETRMGLGIWSYLTGYEDPRISKYFTKGTFF-------D 314 Bacteroides cop...
4MRU_B       288 QEGYYGXRIGINSPfs--dDDXITSYSNRLXTASDPyvWXTASEVAFLRAEGALRKWNXg-GEAKDFYETGVKLSFEEHG 364 Bacteroides the...
EGK05625     312 GPEYLGLRTGIAVPg----KDWADKYSSATYTQTAPtlWLPASEVAFLRAEGALRGWDMg-GTAKELYEEGVKLSFSQWL 386 Dysgonomonas mo...
WP_007575206 310 PRKIIGMRAGANVGn---kAMADALYSAANVKQNDNgiWMTAAEVTFCRAEGALAGWTGmgGTAGELYNQAVTLSFEQWG 386 Prevotella mult...
WP_013265914 302 QRKYIGCRAGAAIGs---nIVAKRLYSTVNVQETTPslWLTASEMAFCKAEGVLRGWNMggGTAKEYYERGVTLSFNQWG 378 Prevotella mela...
WP_027324136 329 GGSYFPIPVGFGIRqdekrEESVYFCSLPNIERTTPvhWLLTSEVLFLRAEGALLGWNMg-GTAENFYTQGIQMSFEENG 407 Bacteroides pyo...
3GZS_B       297 NNGFKAVRCGIAKS-----GDAYNGFTRPNVHEDDPlyWXKASEVXFLKAEGALAGFDXg-GSAGDFYNAGIRXSFSENG 370 Bacteroides fra...
WP_009415283 325 GAKYQGILAGLGEG-----STYFDTFSKPNIEKSTPtyWLRASEVYFLRAEGALAGWNMg-DTAENLYRKGVETSFAENN 398 Capnocytophaga ...
CDA95156     328 GEKYAPIPSGTAYP-----KGTYAKAALPNMTSDTPtyWMRTSEVLFLKAEAALV-WPEf-GDAADLYKKGVEMSFEENG 400 Bacteroides sp....
EJU15931     322 IPGYYFLPPTNNESkk-egANTAQYASKPNFSTETPlyWFRASETFFLKAEAALYGLISt-GTAQSYYEQGVRQSFAEAG 399 Porphyromonas s...
EGJ71169     315 EAHYLAVAPTNSRSke-mgKNTPEFASKPNVYEGSPlyWMRASEVLFLKAEAALFGLIS--ENPKQLYEEGVTMSFEENG 391 Bacteroides cop...
4MRU_B       365 AS--GAEDYL-NSIASPSGYTDP--LGSY------STgSPANITVKWNExg----eqAFEENLERIITQKWIALFPNGIE 429 Bacteroides the...
EGK05625     387 AS--GADAYLqDAVSKPGDYNDP--DPAL------AAkAISTITIKWNDa------dPFETKLERVITQKWIAMYPLGQE 450 Dysgonomonas mo...
WP_007575206 387 VS--GASTYLnNDSDKQADYLNV--EGGYg----sNAsAVSTITVKWDDs------aSEEVKFERLITQKWIAMFPNGQE 452 Prevotella mult...
WP_013265914 379 AD--GVVNYLlDDTSTEANYADA--LGGFg----gAAaKASTITIKWDDn------aSMDEKMERLITQKWIALFPNGQE 444 Prevotella mela...
WP_027324136 408 VPasKAALYI-GSGLKPVDVDMTk-LNRVn----tTIqAVSTATVQFVG--------TQEQKLEKIIIQKWIALYPNGQE 473 Bacteroides pyo...
3GZS_B       371 LDnsSAETYLkDSTRKPANYTDT--SNGEl----sAN-APSSITIRWENg------aTEEEKLERIITQKYLAIFPNGQE 437 Bacteroides fra...
WP_009415283 399 IDisKVSAYL-SSGNEPAEF-----DTYYf----gSApAPTAATTQWGG--------TDEQKLEKIITQKWIALYPNGQE 460 Capnocytophaga ...
CDA95156     401 LSaaAADAYL-TTSFKPEAVS----IFSY------TApAPTEATTEFSG--------TTEQKLEKIMIQKWIALYPNGQE 461 Bacteroides sp....
EJU15931     400 AG--DATAYLaQRGVLPAATTVA--YNPYlssrysDNiSSGNVSPNWNDvda--trnQQEVQLQKIITQKYLALFPNAYE 473 Porphyromonas s...
EGJ71169     392 VK--GVEQYL-KSKSRPTDIDMSnyHYGYy----sAKiSEKNTSPNWNDmnqasnlsQKEQQFQKIMTQKYLALYPNAVE 464 Bacteroides cop...
4MRU_B       430 SWSEHRRTGYPKLLPVVVNKGR---NV-STEA----GXRRLXYPNEEY--T-QNSFHLNNAiNVLIKESsnnqggDTGGT 498 Bacteroides the...
EGK05625     451 AWSEQRRTGYPRFFPVLVNSNTd--AN-LKTR----LASRIPFPPDEQ--N-NNTQNYNEA-VKLLGGQ------DNYST 513 Dysgonomonas mo...
WP_007575206 453 AWCDLRRTGYPKVFAPAQSSAA---NL-SVAN-------RLPLDPKER--V-RNKTNYDKA-VQLLGGA------DDYAT 511 Prevotella mult...
WP_013265914 445 AWNEIRRTGYPRIFSVPQATNG---YT-Ll------TPNRIPFDKNQQ--I-NNRSNYDKA-VELLGGP------DDYAT 504 Prevotella mela...
WP_027324136 474 AWSEWRRTGYPKLHTPLKNTSN---GE-VNSEq---GIRRMHYSIQTArsE-EEQAVYDEA-VKLLDGP------DSPAT 538 Bacteroides pyo...
3GZS_B       438 AWTEWRRTGYPRQIVVAENKTNs--AVlIGNGydlgGVRRLPYPRTEY--E-QNGENLHNAiSQYLGGV------DNAAT 506 Bacteroides fra...
WP_009415283 461 AWTEWRRTGYPKLHPVDQNKSG---GV-ISTDk---GVRRLPYPESKL--StEDKAVLAGA-IRLLGGP------NNGGT 524 Capnocytophaga ...
CDA95156     462 AWTEWRRTGYPVLNQVRDNRGT---GYgVTKEd---RIRRMMYPESFYqsE-QDKANYQDA-LSKLGGN------DSPTT 527 Bacteroides sp....
EJU15931     474 AWTEYRRTGYPFIMKPADTGAPsriGG-DASMr---APERFSFPASAY----DSNPNLKVI-PSLLGGV------DLGKT 538 Porphyromonas s...
EGJ71169     465 AWTEYRRTGYPFILPPEDREAPkriGC-TECL----APERFRYSPSEY----SNNPNMNEI-PSLLGGE------DTGAT 528 Bacteroides cop...
4MRU_B       499 HVWWD 503 Bacteroides thetaiotaomicron VPI-5482
EGK05625     514 KLWWD 518 Dysgonomonas mossii DSM 22836
WP_007575206 512 KMWWQ 516 Prevotella multisaccharivorax
WP_013265914 505 QMWWQ 509 Prevotella melaninogenica
WP_027324136 539 KLWWD 543 Bacteroides pyogenes
3GZS_B       507 KVWWD 511 Bacteroides fragilis NCTC 9343
WP_009415283 525 KLWWD 529 Capnocytophaga sp. oral taxon 332
CDA95156     528 RLWWD 532 Bacteroides sp. CAG:709
EJU15931     539 PLWWV 543 Porphyromonas sp. oral taxon 279 str. F0450
EGJ71169     529 KMWWV 533 Bacteroides coprosuis DSM 18011
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap