3G8Y,3NUZ


Conserved Protein Domain Family
Abhydrolase_7

?
pfam12715: Abhydrolase_7 
Click on image for an interactive view with Cn3D
Abhydrolase family
This is a family of probable bacterial abhydrolases.
Statistics
?
PSSM-Id: 403805
View PSSM: pfam12715
Aligned: 8 rows
Threshold Bit Score: 722.301
Threshold Setting Gi: 501388864
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3G8Y_A         2 YQPEKHAVVKSDRGDGRLLSTYAIVHEXLKDTHPQYAYRSGXSAQEFTQWQDGVRAAXVEIXKFPEIKRQPSPVCVKTEK 81  Bacteroides vul...
WP_008143900  24 WDPEQHAVIVSERGDGRFTSSYAIVHQLVKNTRPSLSFHSEMRPEEMPVWQSEVRQAMMKLMAFPDYLPEKKPICVSQEK 103 Bacteroides cop...
WP_012420430  30 FRAADWAVLHSSRSDQRHVSSRGIVQTMLEKLRPACEFSPDMAPKDFPAWREKVRKAMQQLMKFPPQADIPAPVLVKTVP 109 Akkermansia muc...
WP_005941771  23 FSPEQHKTVCSERSDGRYLSTYGVVHAMLKDTKPLYAFRHDFTRQEFAEWQKEVRTAMIEIMHHPHITGQPIPVCIEKIQ 102 Bacteroides
WP_013548315  24 FQPDRYRVVTTDRSDGRFISTYGIVHQMLKDMKPKYAFNPAFTQNDFLGWQKDVSLAMAEIMCHPQSEKPCTFICVGHEQ 103 Bacteroides hel...
3NUZ_C         7 WSPKDHNLIKSVREDGRFLSSYGVVHAXLRNTEPRYAFHRDFSPKEFRKWQKGLRHAXEEIXKFPQIKNSPAPVCIKREQ 86  Bacteroides fra...
CDE58613      23 FQPEEHATFQTNRTDGRYVSSRAVAHQLMKELEPAFSFRPSMQAADFKTWQKHVRLQMERLMKHPQLQNLPKPVCIRTEQ 102 Parabacteroides...
CDA74689      15 vsqdSASRITTNRQDGRFLSTRGTVQYMLKNVQPAYAFNPSFTPAEFKKWQSGLRDTMKELMRFPQQAAVQAPVCVKTVQ 94  Bacteroides sp....
3G8Y_A        82 KEGYILEKWEFYPFPKSVSTFLVLKPEHL--KGAVPGVLCIPGSGRTKEGLVGEp--gICDKLTEDYNNP--KVSXALNX 155 Bacteroides vul...
WP_008143900 104 RDGYTLEKWEFYPLPQALSTFLVLRPNHL--SKTVPAVLCIPGSGMSKEGLAGEp--gISEKLNDNYTSE--KVSMALNF 177 Bacteroides cop...
WP_012420430 110 REHYRVEKWEAYPFPGAAVPFLVLLPDNAsdKNPVPVLFCIPGSDQTKEELAGE----TSPDLDQPSVQQpgNNAMAFHY 185 Akkermansia muc...
WP_005941771 103 KDGYRQEKWEFYPLPHCVSTFYILIPDKV--KIPGPAVLCIPGSGMTKENLIGEv--sANNM----------RAAMALNI 168 Bacteroides
WP_013548315 104 KDGYKEEKWEFYPLPSCVSTFYVLIPDNV--RQSSPAVLCIPGSGMTKEHLIGRi--sSQNM----------RAAMALNV 169 Bacteroides hel...
3NUZ_C        87 REGYRLEKWEFYPLPKCVSTFLVLIPDNI--NKPVPAILCIPGSGGNKEGLAGEp--gIAPKLNDRYKDP--KLTQALNF 160 Bacteroides fra...
CDE58613     103 RDGYRLEKWEAYPLPACVVPFLVLIPDNLdeKHPSPAVLCIPGWGGTKEELAGEpqlyVPDKPTQES-----KNSMAYQY 177 Parabacteroides...
CDA74689      95 RGGYRVEKWESYPQQGSVVPFLVLIPDGVdaKHKVSAVLCIPGFGGSKEGLAGEn--eGDYELTLSPKEPvkKGAMALHY 172 Bacteroides sp....
3G8Y_A       156 VKEGYVAVAVDNAAAGEASDLECYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDXQVLNWXKAQSYIRKDRIVISGFSLG 235 Bacteroides vul...
WP_008143900 178 VRKGYIAVAVDNPASGEASDLEMYTRGRQYDYEVVSRMLLEIGWSYLGYTSWLDMQVLDWMKQDPDIRKDRIIVSGFSLG 257 Bacteroides cop...
WP_012420430 186 VRQGWAAIVVDNAGTGEEGDAEHAAGRSSHDYENLARFLLEMDWSWLGYTSYADQCILDWVKTRPWAQKNHIILSGFSLG 265 Akkermansia muc...
WP_005941771 169 AKQGYISVAVDNAAAGEAADLEPLT-GTSYDYDTPSRILLELGWSYLGYTSFLNKQVLEWMKCQPFIRKDRIVVSGFSLG 247 Bacteroides
WP_013548315 170 AKQGYIAVAVDNAAAGEAADLEHLS-QVGYDYDTPSRILLELGWSYLGYTSYLDKQVLDWMKRQSMIRKDRIVVSGFSLG 248 Bacteroides hel...
3NUZ_C       161 VKEGYIAVAVDNPAAGEASDLERYTLGSNYDYDVVSRYLLELGWSYLGYASYLDXQVLNWXKTQKHIRKDRIVVSGFSLG 240 Bacteroides fra...
CDE58613     178 VKAGLIAVAVDNPGSGELADLETEAKSYAYDFQTFARSLLELGWNYLGYSSYTNQHILNWMKHHPLMRKDRLIVSGFSFG 257 Parabacteroides...
CDA74689     173 VKKGLVAVAVDNPSCAELSD------NGHFDYLVTSRFLLEMGWSYLGLTAYQDWNVLNWMKTQNYVRKDRIIVSGFSLG 246 Bacteroides sp....
3G8Y_A       236 TEPXXVLGVLDKDIYAFVYNDFLCQTQERAVVXTKPDKENRRPFPNSIRHLIPGYWRYFNFPDVVASLAPRPIIFTEGGL 315 Bacteroides vul...
WP_008143900 258 TEPLMVLGVLDPSIYAFVYNDFLCQTQERAIVMTKPTEKGYRPFPNSIRHLIPGFWHYFNFPDLVAALAPRPLILTEGGL 337 Bacteroides cop...
WP_012420430 266 TEPMMVLGSLNPDIFAFVYNDFLCRTLERAKTMTMPNGRGVRSAPNSIRHLIPGFWKQFDFPDIVAALAPRPVICTEGGL 345 Akkermansia muc...
WP_005941771 248 TEPLMVLGVMDPSIYAFIYNDFLCQTQERAIVMTEPDQRGRRPFPNSIRHLIPDFWKYFNFPDIVASLAPRPIILTEGGL 327 Bacteroides
WP_013548315 249 TEPLMVLGALDPDIYGFVYNDFLCQTQERAIVMTAPDENGRRPFPNSIRHLIPNFWRYFNFPDIVASLAPRPLILTEGGL 328 Bacteroides hel...
3NUZ_C       241 TEPXXVLGTLDTSIYAFVYNDFLCQTQERAEVXTXPDKNGRRPFPNSIRHLIPDFWKNFNFPDIVAALAPRPIILTEGGL 320 Bacteroides fra...
CDE58613     258 TEPLMALGNMDESIYAFVYNDFLCRTRERDLVLTMPDEKGRRGWPNDISHLIPAFLCNFDFPDLVAALAPRPVICTEGGL 337 Parabacteroides...
CDA74689     247 TEALMVLGALDPSIYAFVYNDFLCRTLERILVMSKPDDKGVRHFPNSIEHLIPGFLTQFDFPDLVAALAPRPVICTEGGI 326 Bacteroides sp....
3G8Y_A       316 DRDFRLVQSAYAASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYFKNELVIPWLRK 388 Bacteroides vulgatus A...
WP_008143900 338 DRDLELVRKAYSLSGHPENVEIHHYEKYADPALRHFVSVLPEGLDRDTYFQMVNVDGTNHYFKNEFIFKWLDQ 410 Bacteroides coprophilus
WP_012420430 346 DRDFQLISAAYRMAGAPDHFQYHHQPRFADPAQRWHGSQLPAGLDRDAFFRFANVDPRNHFFKKDLVIPWLKT 418 Akkermansia muciniphila
WP_005941771 328 DRDFNLVKRAYEISGHPENVETHHYQKYTAPETRNTAQNLPEGLGRASFYDSVNVDGPNHYFKNEFVLPWLDK 400 Bacteroides
WP_013548315 329 DRDLDLVRRAYEISEHPENVEIHHYAKFQMEEARNKMDKLPEGMDRNSYYISVNVDGVNHYFKNEYVLPWLER 401 Bacteroides helcogenes
3NUZ_C       321 DRDLDLVRKAYAIVGTPDNVKIYHYKKFSDPDTRKNVEYLPEGLDRNEYFRXVNVDGPNHYFKSELVVPWLRK 393 Bacteroides fragilis N...
CDE58613     338 DRDLNLVKRAYELAGHPENFTFYHYKALQDSTKRKNLMTLPEGLDGETYFKLVNVQPENHYFKSEYIIPWIKE 410 Parabacteroides sp. CA...
CDA74689     327 DRDFDLISKAYKIAGKPDNFTYYHYKKYADPKDRKQIDKVPEGVDLATYFDYANVDPKNHYFKKEWVIPWLEK 399 Bacteroides sp. CAG:530
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap