3HLZ


Conserved Protein Domain Family
DUF3805

?
pfam12712: DUF3805 
Domain of unknown function (DUF3805)
This family represent the N-terminal domain of the structure. In two related Bacteroides species the gene lies immediately upstream from a putative ATP binding component of an ATP transporter and a putative histidinol phosphatase. The structure of this domain is strikingly similar to the N-terminal structure of 1tui, also of unknown function. The domain carries four conserved tryptophan residues.
Statistics
?
PSSM-Id: 403803
View PSSM: pfam12712
Aligned: 14 rows
Threshold Bit Score: 267.328
Threshold Setting Gi: 493796602
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HLZ_A         5 K-KFISPGAWFSXNYPSDWNEFEDGEGSFLFYNPDVWTGNFRISAFKg------NASYGKDAIRQELKENDSASLVKIGT 77 
wustl:BV2865   1 M-KYISPGGWFSLEYPMGWHEFEDTEESFLFYNPDRWTGNFRISAYKd-----eAADYGPQCIAYELKENTSSALVKVGK 74  Bacteroides vul...
CDD81542       4 K-RYIAPGGWFALYYPERWSEFEDEEGSFLFYDPEKWNGNFRISAYKd-----rSSSYARESVADELRQNDQARLKTVGS 77  Bacteroides sp....
WP_022277451   1 M-KYISPGSWFSLEYPNDWREFEDEEDSFLFYNPEKWNGNFRISAYRg-----kSAKYAQDCMADELQQNQSARREQAGP 74  Bacteroides cop...
CDA75915       1 MqKYISPGAWFSIEYPSDWHEFEDTEESFLFYNPDKWNGNFRISAYIg-----eNKGYAQYCMDEELKHVDGARTTTVGD 75  Bacteroides sp....
CCZ86173       1 MkKYISPGAWFSLEYPDNWCEFEDSEDCFLFYNPDKWTGNFRISAYRg-----nSSAYANECLEDELHQVRGAKKVKVGS 75  Bacteroides ple...
CDD32875       1 MmKYIAPGSWFSLEYPSGWREFEDTEDSFLFYNPDKWGGNFRISAFRg-----eNRSYARECVDYELKQTQGARLVKVGG 75  Bacteroides sp....
CDB99792       1 MmKYISPGSWFSLEYPSDWREFEDTEDSFLFYNPDKWTGNFRISAYQg-----eNRNYAQECIEYEMQHSRGVKLVKVGK 75  Bacteroides sp....
Q5LF03         5 K-KFISPGTWFSMIYPSDWSEFEDGEGSFLFYNPEHWTGNFRISAYKedaaapgGMNYGKDSVRQELKENPSASLVKVGH 83  Bacteroides fra...
WP_117680497   5 K-KFISPGAWFSMTYPVDWNEFEDGEGSFLFYNPNEWTGNFRISAFKg------NATYGKDSVKQELRENSSAIPVRIGR 77  Bacteroides uni...
3HLZ_A        78 WDCAYSKEXFQEEGTYYTSHLWITGTGNIAFECSFTVPKGGSAKEAEEVIATLEARKEGEKYPAELIPVRLSEIYQIN 155
wustl:BV2865  75 WDCAYSAETFQEEGAWYTTHIWVTGEGDLSFECSFTVSKGGDKHPAEEIIRSLQVRKEGVSHPREIIPIRVLEIGEVN 152 Bacteroides vulga...
CDD81542      78 WECAYSCETFMEGNEAYTTHFWLTGAGNVSVECSFTVAKGSSVETAEDIIASLEIRPDNRRYPKEYIPVRVLEINEIN 155 Bacteroides sp. C...
WP_022277451  75 WACVYSAETFQENGAWYTSHIWLTGKGTISVECSFTVPKGESPRMAEDIIRSLKVREENEPLWKEVIPVRALEISVIN 152 Bacteroides copro...
CDA75915      76 WKCIYSVESFQENGAWYTTHIWITGAGAVSVECSFTVAKGESIRVAEAIIASLRVRQKEERVGRVVIPVRVSEISVIN 153 Bacteroides sp. C...
CCZ86173      76 WDCAYSSESFQENGVWYTTHIWVTGRGEISVECSFTVAKSESPKAGEAIVASLKVRNVSDKPMKEVIPVRILEINQIN 153 Bacteroides plebe...
CDD32875      76 WDCAYSTENFQENGSWYTTHLWVTGKDSISVECSFTVTKGESIKVAESILASLWVRGDADKPLHEVIPVRVLEIDVIN 153 Bacteroides sp. C...
CDB99792      76 WNCAYLTESFQENGVWYTSHIWVTGKDSISVECSFTVTKGESAKVAEQIIASLNVRGAGEKPWKEIIPVRVLEINAIN 153 Bacteroides sp. C...
Q5LF03        84 LECAYSKEMFEEEGIYYTSHLWVTGIDNVAFECSFTVPKGEHVDEAEKIISSLEIRKDGQKYPAEIIPIRLSEIYQVN 161 Bacteroides fragi...
WP_117680497  78 MECAYSKEMFEEEGAYYTSHLWITGADEVAFECSFTVKKGEQVAEAEKIIASLETRKDGVKYPAEIIPVRLSEIYQIN 155 Bacteroides unifo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap