3HZP


Conserved Protein Domain Family
DUF3804

?
pfam12707: DUF3804 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3804)
This family is approximately 130 residues. Dali search indicates this protein carries a NTF2-fold with a hydrophobic cavity as a structural homolog to 1JB2, 2R4I, 3FSD and 2UX0. In this hydrophobic cavity, Arg 118 provides the H-bonding force to hold a PEG molecule from crystallisation. The interface interaction suggests that the biomolecule of PMN2A_0505 is a dimer. Two members of the family are annotated as putative EF-Tu domain 2 but there is no match to this family so this is likely to be a false assignment. There are two highly conserved tryptophan residues towards the C-terminal end of the family.
Statistics
?
PSSM-Id: 403799
View PSSM: pfam12707
Aligned: 2 rows
Threshold Bit Score: 223.359
Threshold Setting Gi: 251837134
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HZP_A   3 SSKEEILSILEAFASTERXGSFFLDNATADFLFIRPSGNPLDAKGFENXWSSGDLVLESAEITKVHKFElLGSNAAICVF 82  Prochlorococcus marin...
Q46H33  23 SDSQQLEALIQSFADRSQNKTFLLANTTNDFLAIRPSCNPIIAKGLAGMYDSDDLVIELSELVKIHRLE-ADSDWGFTAF 101 Prochlorococcus marin...
3HZP_A  83 TLGSKFTYKGTQNDDLPTVTSIFKKIDEKWKVAWXQRSSGQSDXTLWN 130 Prochlorococcus marinus str. NATL2A
Q46H33 102 TLKEVFSYKGDLNNDLSIYSLIFKKIDGIWKIVWMQRSQGTTDISTWD 149 Prochlorococcus marinus str. NATL2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap