2QNT


Conserved Protein Domain Family
Glyoxalase_2

?
pfam12681: Glyoxalase_2 
Click on image for an interactive view with Cn3D
Glyoxalase-like domain
This domain is related to the Glyoxalase domain pfam00903.
Statistics
?
PSSM-Id: 403776
View PSSM: pfam12681
Aligned: 6 rows
Threshold Bit Score: 159.499
Threshold Setting Gi: 81434357
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QNT_A     9 FVNPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGF--AI-----H--EGrsLEETIwrtSS-DA-QEAY-GRRNX 76  Agrobacterium fabru...
Q97LL1     3 FNCPLIVVNDINISRKFYEEVLCQKIKYDFGENVVYEGDF--SL-----QlkSH--FANMI---DI-DEkSIKF-QSNGF 68  Clostridium acetobu...
Q187Q5     3 FGGVLLIVKDINKSKKFYEDVMEQKITLDLGEHVSFENGF--GL-----Q--SN--YKAII---GY-DL-PIYQ-QSNNF 65  Clostridioides diff...
Q8TUF9    12 FICPLIVANNMEISRNFYEKVLDQKVQYDFGENVSFEGGFviHL-----K--SH--FSDLI---NI-NKnDIAQ-KSNNS 77  Methanosarcina acet...
Q81BZ3     5 MKYIILYVEKFEECLKFYKDILQLPIKAEHGTYIEFNTGT--TIlamntR--QD--VKELT---GL-PL-TEGElQSSHF 73  Bacillus cereus ATC...
EPS50494   3 FKLALLAVKNVSVSRQFYEELFDQKVILDLGKNVTFSGGF--AI-----Q--ED--FAWLT---NVaSD-SVIE-RSNNM 66  Clostridium botulin...
2QNT_A    77 LLYFEHADVDAAFQDI--APHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESLS 129 Agrobacterium fabrum str. C58
Q97LL1    69 ELYFEEDNIEAFLNKLkqNKGINYIHSLLEHPWGQRVIRFYDPDMHIIEVGESME 123 Clostridium acetobutylicum
Q187Q5    66 QLYFEVNDIKQWESKInrIGNIEFLHYIKEYPWGQRTFRFYDFDKNIIEISESME 120 Clostridioides difficile 630
Q8TUF9    78 ELYFEEADLDSFLQKLkdIDSIEYVHGLKEQPWGQRVIRFYDPDMHIVEIGEPME 132 Methanosarcina acetivorans
Q81BZ3    74 ELGFVVENVQETIEQFreQG-IKILVEPIVKPWGQTIAYIADPDGNYIEICSSLE 127 Bacillus cereus ATCC 14579
EPS50494  67 ELYFEVDDFDAFMQKIqeYENIKYVHQPKKYKWKQRVVRIYDPDHHIIEIGESMA 121 Clostridium botulinum CFSAN002369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap