Conserved Protein Domain Family
Stn1_C

?
pfam12659: Stn1_C 
Telomere capping C-terminal wHTH
This domain consists of tandem winged helix-turn-helix motifs. Stn1 and Ten1 are DNA-binding proteins with specificity for telomeric DNA substrates and both protect chromosome termini from unregulated resection and regulate telomere length. Stn1 complexes with Ten1 and Cdc13 to function as a telomere-specific replication protein A (RPA)-like complex. These three interacting proteins associate with the telomeric overhang in budding yeast, whereas a single protein known as Pot1 (protection of telomeres-1) performs this function in fission yeast, and a two-subunit complex consisting of POT1 and TPP1 associates with telomeric ssDNA in humans. S.pombe has Stn1- and Ten1-like proteins that are essential for chromosome end protection. Stn1 orthologues exist in all species that have Pot1, whereas Ten1-like proteins can be found in all fungi. Fission yeast Stn1 and Ten1 localize at telomeres in a manner that correlates with the length of the ssDNA overhang, suggesting that they specifically associate with the telomeric ssDNA. Two separate protein complexes are required for chromosome end protection in fission yeast. Protection of telomeres by multiple proteins with OB-fold domains is conserved in eukaryotic evolution.
Statistics
?
PSSM-Id: 403758
View PSSM: pfam12659
Aligned: 14 rows
Threshold Bit Score: 118.528
Threshold Setting Gi: 74608891
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EJT41425     363 KSLDTCENETFQNLVDGLANLGLIELRgvASKVLDLLPLRKLFDYAQKRILVLVKLQCYTGTIELHHVQEKLHLP-CIT- 440 Saccharomyces k...
XP_002556189 334 RPVDEVASSLFADVLQRLARAGLISVFa-QGRILNLRVLKNCDDYVTQRIAALVELRSYTGKIDFRRACDLLGLA-RSAp 411 Lachancea therm...
XP_001646308 312 KGLEDIKIEVFYKLLKTFSKNGLIKYI--DETEIDLSLLHKIYKNFQRQVSVLILLRCTTGNIDLTKLKQLPDIN-SSS- 387 Vanderwaltozyma...
XP_003674869 355 KTVEEIKAGIFYDYLERLTKMGLITISt-HGNLIDLKSLKQLSRYCQRRLSTLIRLQSLCINVDYNFIRQKLKIS-NLT- 431 Naumovozyma cas...
CCD22511     401 KSFEEIKSEQFINYIKSLVASTVVELTs-NDNVIDLSILKKVSKYCNERLNISIKLQNLSISIDYKYIKQKLSLK-QFK- 477 Naumovozyma dai...
CCE61285     416 nkfsHYEFTLLKEYLVDLQKIELIRVNn-AGDTMDLNNLHRLFSYCHKHCKLFINLKYNTVTINHSLIKKKLDIH-KVP- 492 Tetrapisispora ...
Q6FM89       316 ISNDDMQI-ILQEYLSQLITGDVLVIT--ARNRVSLKKLHALKAYTQKRINLLLKIQALLGTVRYQDVLQSTSMA--IP- 389 [Candida] glabrata
CCK71703     317 ysQDQLISMIFINELNHLQALHLIRIEd-HNNQIMAKPLQNLYHYARGKIRLWIKLRTGVGIVNNVQIIDRLTLDrEIS- 394 Kazachstania na...
Q6CTL1       318 KTEPVLHLKFYETFLAQLAEMAIITL---DSFTINMTNLHNCYRYIITRFQSLINVQIPQITIKYSEIRNFCKLP-LLS- 392 Kluyveromyces l...
Q74ZP7       313 AGLEKTKALLYDSVLAQFCTMGVLSLE--GSDQIQLHLL-PVKEHIVARIDTWLKLHVRAGKLLYHQVRSTCGLP-QMS- 387 Eremothecium go...
EJT41425     441 -INGIISVFKEGLKQTANQ-YPQVLKKWWIDLNSKNGSEdqrngflLHLEYV 490 Saccharomyces kudriavzevii IFO 1802
XP_002556189 412 lERLLVDLHKRALRRLAAA-SDTPLQSWWIELAGPAAAF-------VHFEYH 455 Lachancea thermotolerans CBS 6340
XP_001646308 388 -NIEFADILQESIEKIAKS-SPNLLKIWRIKKIDKNNYK-------LNFVYH 430 Vanderwaltozyma polyspora DSM 70294
XP_003674869 432 -KLAIISIYKETIKVFIKA-SPSLLKSWWIDLKNDTIAL-------IHLEYS 474 Naumovozyma castellii CBS 4309
CCD22511     478 -NMMIIEIFKENIKIFTMN-TSSIIKNWYIDLKNEKIAI-------VYLEYy 520 Naumovozyma dairenensis CBS 421
CCE61285     493 -DMVIINIYRESIKNFVNQ-NPRLLKSWFIEVNANRSSI-------LYLKYp 535 Tetrapisispora phaffii CBS 4417
Q6FM89       390 -AETIIDAFKESLRTIDAG------VAWFIETHQHSFT--------IHFTYS 426 [Candida] glabrata
CCK71703     395 -SNVIALVFKLVMDDTVSTlSQNFIRSWFIETKNDNTSW-------VHISYt 438 Kazachstania naganishii CBS 8797
Q6CTL1       393 -KKLILQMCKHFLNTT----HIGNLIDWWVDPTSEERYK-------VFFTYS 432 Kluyveromyces lactis
Q74ZP7       388 -APFIVNLTKVLLRQHISQ-RTELVDSWFLDAKSEERGYl-----lVRFNYI 432 Eremothecium gossypii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap