Conserved Protein Domain Family
TcpE

?
pfam12648: TcpE 
TcpE family
This family of proteins includes TcpE a conjugative transposon membrane protein.This family of proteins is found in bacteria. Proteins in this family are typically between 122 and 168 amino acids in length.
Statistics
?
PSSM-Id: 403750
View PSSM: pfam12648
Aligned: 23 rows
Threshold Bit Score: 63.8383
Threshold Setting Gi: 81437375
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8DX52         8 DYSRGLNAPYWIQEVKTakgkviWYFSTP---MQLSFFIVFFIILMLMLTVCSPLMQvlNALTHSVSM----------LL 74  Streptococcus a...
WP_011877166   5 SYKSLFKIKFKIYSIGK------YQLARP---IPLDTLGILIILALPSYLIAGPIAGafgt--------------nrvAT 61  Desulfotomaculu...
Q838G7         5 NYTREFKQPHKIYSIKG------VALPFApngIRLEQIFVGIGILILLLIFAIISFV--AKINFFTTIian-----fwLI 71  Enterococcus fa...
WP_012961279   5 NFTKEYKYPIKIYRIGQ------IEFANG---LEVRKMIVAGVVIFMMVLMFFIFGAsshagaiq------fllgnwlII 69  Bacillus pseudo...
P96641         7 NYRKAMREPKKIQQLTEn-----YSLPFA---VELIPAINYFIFVGLCFGF----------WYGVRmifphafdnsyvIV 68  Bacillus subtil...
WP_023520792   8 NYKKALNVPYMVQKLTKk-----FSLENP---IKVTKIAVFALTLLSLFTI----------FKPLMIMlrvip-gldlAC 68  Enterococcus mu...
AEJ87170      16 DYKEPFQAPYMVREITKk-----LRLRNA---ISGQTIFVFGFTALLCLVLfypflg---------------fnqfymML 72  Enterococcus hi...
BAK60867       9 dYAIGLETPYWIQEIRLrgk-vyWTFQTP---LSVPFLGVTALSAVAVFLF----------IHPLLPVlryvp-fvpvAL 73  Lactococcus gar...
Q831I9         5 DYSRGLKAPYSMQVIKSpkgqvvWVFAQP---VSLSYLLILFLGIVLTGLFwkevplpq-----------ilginlnlLI 70  Enterococcus fa...
Q839K9         5 DYSRGLKAPYSLQVIKSpkgkivWYFAQP---LSLAYLVMLFLGIVLTGIFwkfvplpl-----------ifginlnlMI 70  Enterococcus fa...
Q8DX52        75 YWFVPSKLAKFYVEYEPQGKKMHIFLWDYLVYLKDFGLNKKGIYQ 119 Streptococcus agalactiae serogroup V
WP_011877166  62 AILVDFLLTSFAHKFDPQGRPFLEFVYDIFTFIFRPK--KRDFYE 104 Desulfotomaculum reducens
Q838G7        72 LIVGVGVLVWTLFSLKWDNKSFLDYLIGRGNFLYQKK---KRYEH 113 Enterococcus faecalis
WP_012961279  70 LVCVPAVITFVVFSMKYDHKPVIPFMKDRLRF---YKMKNKAYEH 111 Bacillus pseudofirmus
P96641        69 IFGIPFFLTMLVTKIKPEGKNIYIYFFDFAKYYFFIKLPQKKYCN 113 Bacillus subtilis subsp. subtilis str. 168
WP_023520792  69 YALIPISVTMMYDSVEPDGLKIYHYLWDSVSYILQYKLIPKRIYQ 113 Enterococcus mundtii
AEJ87170      73 SIAIPYGMVELFNRVEPDGKKVHVFLLDYLRFVMIYQIGKKVIQq 117 Enterococcus hirae ATCC 9790
BAK60867      74 CTILPWFIGKSYVEKEPDGKKMHYYIYGVFRFIKNFGFDKRCIYA 118 Lactococcus garvieae Lg2
Q831I9        71 MVLVPNKVARWYSEKEFEGKTGFGFLKDGFVYVKNYVLdsrpiva 115 Enterococcus faecalis
Q839K9        71 MLYFPNKVARWYTETEFEGKTGLAFLKDGFVYVKNYVLDNRsiis 115 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap