Conserved Protein Domain Family
RELT

?
pfam12606: RELT 
tumor necrosis factor receptor superfamily member 19
This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 49 and 288 amino acids in length. There are two completely conserved residues (K and Y) that may be functionally important. The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis). The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1.
Statistics
?
PSSM-Id: 403713
View PSSM: pfam12606
Aligned: 13 rows
Threshold Bit Score: 61.5249
Threshold Setting Gi: 558114690
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001188289  26 NIAFILVPFFFLMGLLGVLICHILKRKGYRCTTEAEEEEQLE 67  zebrafish
XP_015200354  34 YVAFVLVPIFFLLGLFGVLICHVLKRKGYRCTTDSEEETEIE 75  spotted gar
XP_004009811  58 YIAYALVPVFFVMGLFGVLICHLLKKKGYRCTTEAEQDVEGE 99  sheep
OCA48066      49 YVAFVLVPIFFIMGLIGVFICHMLKKKGYRCTTEAEPPVDEK 90  tropical clawed frog
XP_006001449 181 FAVLAIVPIFCLTGLLGILLCNFLKKKGYHCMSEKEAEEEAG 222 coelacanth
XP_006086496  16 YMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDT 57  little brown bat
XP_005995390  20 YILFLLVLLFFGTGLLGILICHILKKKGYRCRTSLEEPDPRA 61  coelacanth
Q1RLT5        16 YPIFLLVFFFFITGLLGFLICHLLKTKGYRCELEEDEEDCEG 57  zebrafish
XP_015205332  16 YMIFILVLFFFLTGLLGFLICHVLKKKGYRCRTGEPEEECED 57  spotted gar
XP_007551385  23 YLAFALVLAFFVVGLTGVVVCHVLKKRGYRVTTAQEDDGYDD 64  Amazon molly
XP_011485839  20 YIAFVLVPVFFLLGLLGVVICHILKKKGYRCTTAQNDEECDA 61  Japanese medaka
CAF96695      28 YVAFVLVPVFFLLGLLGVVICHVLKRKGYRCTTEPQDGGKEA 69  spotted green pufferfish
XP_020495642 162 YAVFALVPIFCVMGLLGILICNILKKKGYRCSADKEGGDEET 203 ballan wrasse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap