Conserved Protein Domain Family
DUF3769

?
pfam12600: DUF3769 
Protein of unknown function (DUF3769)
This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 560 and 931 amino acids in length.
Statistics
?
PSSM-Id: 403710
View PSSM: pfam12600
Aligned: 48 rows
Threshold Bit Score: 448.576
Threshold Setting Gi: 123620433
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAK29237           549 RGEITHWRFQSPQLLLTPEGWSAPRISFTNDPFTPAQSWVDMRDVRSEQESDGTTV--VRSKSNRLLLENKLPLPL-PKT 625  Synechoc...
Q31MI3             261 RGGVQNVRFQADRLDLRPDGWTAQDIALTNDPFAPPQAEIRSAQATYQAPPNGLGS--LGIFGSGLVLENSLRIPLpDNN 338  Synechoc...
WP_015109633       582 KGTVSRWRIQARRLKITPNTLSGDRVGFTNDPFTPAQSWMDSEKVVITLLPNGDTL--VKARRNTLRLEDRLPIRV-VRQ 658  Cyanobiu...
CAK22735           592 TGEISRWRIQAARVRLTPDGWSADRMGFTNDPFTPAQTRIDAENVVATEEDNGDIL--IKSERNRLIVEERLPIPV-SRT 668  Synechoc...
Q7V4U8             542 TGSISRWRIQAANVTINPEGWKADRMGFSNDPYTPSQTRIDAEDVIATEEPSGDIV--IQSRRNRLIIEDRFPIPV-SRT 618  Prochlor...
Q7VDT2             219 NNSINKWRIKASKILLENDLWKAQKVSFTNDPFNPAQTKIDSYEVEVKVIKDVEKKviITAKKSYLIVEDKFKLPI-GNR 297  Prochlor...
Q2JLW7             112 lspqrLVRFRAVRIRFDATTWEGEQVRLTNDPLDPPELEIRSPRVTSTLQADGSSL--LIAEAGQLAFDQVLFLPLpI-R 188  Synechoc...
ASGPB:GKIL_2137    187 karggiLRFHARRITFSPQGAKAEDLRATPDQFDPPELEVISNRATLVPNGPGSNR--LTIDSGTILFDQTTTLPFpTIL 264  Gloeobac...
Q7NF94             190 kprggiLRFEAKRIVFNAEGWRAEDLRVTPDQFDPPELELVSARATLREIGPGSNR--LMIDSGTLFFDQNFAMPFpAIE 267  Gloeobac...
jgi:Syn7502_03127  207 SKAISRVRFKADKIFLDGDTWTAENLKVTNDPYDPPELEIRANKATLTKITPTQDR--LDSESPTLVFDQGLTLPVpFNS 284  Synechoc...
CAK29237           626 FRFSPEEEQevSNRWSVLADTQDRD----GIFLQYQLPEQtLFGSTRLSVRPQFMLERAFDgttntypapt-asagsgdv 700  Synechoc...
Q31MI3             339 SVVQERE----GGILTIGFDGVDRN----GAFLEREFSVI-NENNLQLSLTPQFLVQRAInlagggre------lgndve 403  Synechoc...
WP_015109633       659 RRIQKQEEV--SNPLVIGNDREDRD----GFFLGYNI-PVrIGEKGLLNLQPQVMVQRLYTgntdayplpgspagstniv 731  Cyanobiu...
CAK22735           669 QRIQKQEEV--ENRWVLGIDNDDRS----GFFIGRNLRPIeFSEDLVLELQPQFLLQRAINgdnnsyvapg-ssidsnkv 741  Synechoc...
Q7V4U8             619 QTIKKQEEV--ENRWVFGIDNNDRD----GFFVGRDLKPIeLTKNYTLSLQPQFLLERAIDgetksyvapd-ssidsqki 691  Prochlor...
Q7VDT2             298 KFVSGKEKE---KNWVLGFDGTNKD----GLFIGRQLRPIqLSDSYKLFMQPQYLIQRSIKgetdaypvrg-gtilskkv 369  Prochlor...
Q2JLW7             189 LRFDSLNRQ--P-PVSIFYDDFDREelrrGLILQPNFELL-RDPNVSLVLSPQLYPQRLWgs------------------ 246  Synechoc...
ASGPB:GKIL_2137    265 STIDKERRK--P-PYEIGADYFDKG----GIYYQQNFYID-FSNKSWLSFSPQFYIQQAFss------------------ 318  Gloeobac...
Q7NF94             268 SVIDNEKRK--P-PYEVGSDFLDKG----GVYYQQNLYVE-FAKNITFQISPQLYIQQALss------------------ 321  Gloeobac...
jgi:Syn7502_03127  285 IVLDRFERS---FPVRIGFDRRDGG----GFFYQQNFNAY-TEPNISFQVSPQIFLQRGLe------------------- 337  Synechoc...
CAK29237           701 vqDNTTGDLFGVKALW---SGPVG-DANFNLEADISSFAPSNLSNATRSSAQWNQ-PLQWAAlgNPLARAFGAYRYRVWN 775  Synechoc...
Q31MI3             404 vnSVNPLDAFGLVGRL---NANLApNTQFSLITNLASLNPENLSTQSRISSDLRQ-DFGFf-----DILLNYRYRERRFN 474  Synechoc...
WP_015109633       732 eqPAKGGDYFGLDARL---TGPVL-GFNADARLSISTFNPDNFANGTRSFGDLSR-LVKVPVlgFSTLRLFGAYRFRTWN 806  Cyanobiu...
CAK22735           742 tqDNTVGDLFGLEAEL---NSEFL-GLSTKIEADISTFNPSNFSDGSRFWGTTRR-TVTLPWigDVSARVFGAYRYRTWN 816  Synechoc...
Q7V4U8             692 tqPITAADLFGLEAEL---TGSTL-GWDVDINADISTFNPQNIANGSRYWGDLKR-NFDIPWigSLQANLFAAYRYEAWN 766  Prochlor...
Q7VDT2             370 saSTNYSDLFGLEAQL---QGSIL-NWDNNFEADISTFNNERFANGARYSGDFKK-KFNFAKvkDLEAVLFGLYRYQIWN 444  Prochlor...
Q2JLW7             247 eqGLLDG--IGLRADFrwrQPEANaQTSL--FAELRGIVFQEFAQRLRAQVEHRI-TTGDGG----EVAYTYAYRERFFS 317  Synechoc...
ASGPB:GKIL_2137    319 -rGFLDPANFGIQSKL---NLDYGnGQITKVFLELNGLDLGNLENRLRGRIDQIL-PLGNh-----TLTFNFSYNERFFN 388  Gloeobac...
Q7NF94             322 -nSFLDPKNFGLQNKL---SVEYDnGQLTRLFSEINGLVLDDLENRVRARLEHIV-PVGNh-----TLTFSYAYRERFFN 391  Gloeobac...
jgi:Syn7502_03127  338 -gNLLDANILGVVAKL---DAILPdSQFFTGRATLSGLNLANAENQLRANIQYSRpVLGDh-----ILVAQYAYRDRLFN 408  Synechoc...
CAK29237           776 GSLGMQDVYSAYGVSLQN-----------------QSDsprQVGPFQVSSYWRAGVGNYQSNGFIAGNT--------ESN 830  Synechoc...
Q31MI3             475 GSLGVQTVQQSYGLTLETrrldllalagvspsttfPRI-------DGLNFRFQASYQNLLALTDQPNLIgt-----qPSP 542  Synechoc...
WP_015109633       807 GSLGEQDVYSAYGVSLEQ-----------------QGSl-pSWGSISRSYYWRMGVGNFQANPT-------------TGT 855  Cyanobiu...
CAK22735           817 GSLGETDVYSAYGGFAEQ-----------------KGNw--SWGQLKNDYIWRFGVGNYQAESF-------------TST 864  Synechoc...
Q7V4U8             767 GSLGETDIYSAYGAFLQK-----------------EGDw--SWGKLRNNFLIRTGVGNYQAESF-------------TNE 814  Prochlor...
Q7VDT2             445 GSLGSSDIYTAYGARIDK-----------------EGKw--ANKKKKFEYNVSTSFGTYQGENL-------------AKT 492  Prochlor...
Q2JLW7             318 GRLGFQIVENRLGASYRS-----------------PTL---RLGNTGLDLSYRIAADYIDALGQPDEIdtdpelalaNTT 377  Synechoc...
ASGPB:GKIL_2137    389 YVVGYQIAHSILGITLDS-----------------PVI---NLGNTGVLLSYQVNAALINAISDRPNL-----------P 437  Gloeobac...
Q7NF94             392 YLLGFQTAQSNLGITLDS-----------------PLI---TLGSSGVRLSYQANAALISANTDQPQL-----------D 440  Gloeobac...
jgi:Syn7502_03127  409 GSLGFQDVSNSLGVNLFS-----------------PNY---VLGDSGINFSYQVGAQYIGADSDRSDS---------QPI 459  Synechoc...
CAK29237           831 NFADLWRANAYGTLQMNWPLWTGKSLPLTPEGAYRYSPVPIIPGLQLTLVPFVNAAAYG---GGQGQSLLGLSGGPVLTL 907  Synechoc...
Q31MI3             543 ALANLNRFQLETGLALPITLWREEALPATPDAGLRYTSAPVSPGLRIVPEITGVISNYS---DGTSQNSIAYRFGADLTL 619  Synechoc...
WP_015109633       856 DLLQLWRANAIGSMNFSLPIWTAKPTSSPPVVSLANTPVPIVPGLRFNANLLGVAAYFS---DGTNQNTIGLSGGPTLTL 932  Cyanobiu...
CAK22735           865 NLIDTLRANFYGSLNSRYQLWRGQPAELTPEAAYRYSPVAIVPGLELRTNVNTSLAAFG---DGNRQNTISLTGGPTLTL 941  Synechoc...
Q7V4U8             815 NLSDLWRINFYGSLNSRYPVWRGKPAALTPEAAYRYSPVAIVPGLDFRTNLRATLSAYSseiNTATQNTITFSAGPTLTL 894  Prochlor...
Q7VDT2             493 GLIELLRVGIISEFDIKYPLNIYNNKDKNRNKITVYSPRPIEPGFSIDTNIISSYFNYE---NGNNQSSFEIGLGPSLTI 569  Prochlor...
Q2JLW7             378 DRIQLSRLQLGATLNRSFPLWSPPKTAADPPP--RFSALPIEQGIWLSTGVSSSQSFYS---NGRAQSYTAGSIGIDAVI 452  Synechoc...
ASGPB:GKIL_2137    438 AQPDLSRLRLAGSLSKQIPLVVGTYLPPSR-ETLRFTQQPVTPGLWLDLGTTLSQSWYS---SGDSQTYLGGRVGLSTII 513  Gloeobac...
Q7NF94             441 RQPDLGRFRVAGSLSKTITLLQAEFLPLSR-ETLRFTQIPVTPGLFLDVGTTLVQSWYS---SGDSQGYLGGRVSLFSIL 516  Gloeobac...
jgi:Syn7502_03127  460 VVASLARLQGATALSRSFPLWRGTALPAERETGLKYLPEPVTPSFDAFLGVAGNYAFYS---SGDYQSYLSATVGVVGVF 536  Synechoc...
CAK29237           908 GHFNRPLFDYTKLSLFGSATAKAGNSPFAFDRYVDTATLGVGLTQQLIGPLVLDGAISYNVAGdsdfyGDVTNNYFEIRW 987  Synechoc...
Q31MI3             620 GKFAGDFFDYTNLRVDYLRSTGEGFSPFLFDRLVDRNVLVLGATQQLFGPFLVGVTSAINLDT-----NQAFNTTYRLEY 694  Synechoc...
WP_015109633       933 GRFEKPFFDYTQLTITGGITLRQGQSPLNFDRAVDLGTVGIGLSQQIVGPLVFSGGIGFNVDPnsgfyGDVTGSYLELRW 1012 Cyanobiu...
CAK22735           942 GTFSKPFLDYTQLSIAGGGTLKQGSSPFEFDQAIDLGTLGIGLTQQIAGPLLLNAGVGVNIDPasefyGNVINSNIELRW 1021 Synechoc...
Q7V4U8             895 GTFSKPFLDYTQLSLSGGITLKEGESPFEFDQAVDLGTFGIGINQQIAGPLVLSAGIGMNVDPdsiyyGDIINSNIELRW 974  Prochlor...
Q7VDT2             570 GSFTRNYLDYTKLSLMPSITFKGGDSPFAFDNINDLAKLKVNLSQQLIGPIVIKNIYHVNIDSdssnyGKTISWKSGIIL 649  Prochlor...
Q2JLW7             453 GAFVADTFDYTNLRVTYSNGFLAGASPFLFDRITTREQLVLGFLQQLYGPLRVGAETTVDLQS-----GQQVDVVYRLGY 527  Synechoc...
ASGPB:GKIL_2137    514 GRFTKDLFDYTSLNIGYNNGYVSGLSPFLFDRVASAQQIYGGIQQQIYGPVRAGVQVAYDLFF-----RKVVDNYFSLSF 588  Gloeobac...
Q7NF94             517 GRFSRDFLDYTALSLSYNNGFVNGESPFLFDRVASREQVFAGITQQIYGPLRFGVQTGIDLTF-----GRAVDTFYTVSL 591  Gloeobac...
jgi:Syn7502_03127  537 GNFAQPYFDYTKINISYTQGIVGGRSPFLFDRIADPQVFTFGIVQQVYGPFRVGIEQSWNPVS-----GRIVDSNYSLQY 611  Synechoc...
CAK29237           988 QRRAYQFGVFYSPYTGIGGLRLKLNDF 1014 Synechococcus sp. RCC307
Q31MI3             695 SRRAFGVSLSYNPDQQVGILAIQLNDF 721  Synechococcus elongatus PCC 7942
WP_015109633      1013 QRRSYEIGVYYSPYDGLGGIRVRLNDF 1039 Cyanobium gracile
CAK22735          1022 QRRSYDLGFYYNPYEGIGGFRFRLNDF 1048 Synechococcus sp. WH 7803
Q7V4U8             975 QRRSYDFGFYFNPYQGIGGFRFRLNDF 1001 Prochlorococcus marinus str. MIT 9313
Q7VDT2             650 QRRSYEIGLSYDFKNQSGGFNFRLNGF 676  Prochlorococcus marinus
Q2JLW7             528 DRRTYGFSLQYNPVRQSGALELRVEGL 554  Synechococcus sp. JA-2-3B'a(2-13)
ASGPB:GKIL_2137    589 DRRTYSLSLIYNPVLQTGGFQLRVDDF 615  Gloeobacter kilaueensis JS1
Q7NF94             592 DRRTYSLSITYNPVRQTGGFQLRVDDF 618  Gloeobacter violaceus
jgi:Syn7502_03127  612 DRRTYAIVIRYNPTREIGELVFRISDF 638  Synechococcus sp. PCC 7502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap