3LXU


Conserved Protein Domain Family
TPPII_N

?
pfam12583: TPPII_N 
Click on image for an interactive view with Cn3D
Tripeptidyl peptidase II N terminal
This domain family is found in bacteria and eukaryotes, and is approximately 190 amino acids in length. The family is found in association with pfam00082. Tripeptidyl peptidase II (TPPII) is a crucial component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. It is an amino peptidase belonging to the subtilase family removing tripeptides from the free N-terminus of oligopeptides.
Statistics
?
PSSM-Id: 403697
View PSSM: pfam12583
Aligned: 7 rows
Threshold Bit Score: 148.926
Threshold Setting Gi: 568248056
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LXU_X              1035 SNGSSAAGST--ATAAAVTTANGAKPKAPatpQAATSV--TNPAAGDGISVQNDPPVDS-SGSPASPKKGKANADDYAES 1109 fruit fly
WGS:AAQB:GK21633-PB 1036 GNNNSSSNATp-AAAAVAVNANAAKPKAQ---QATVSV--NSPAAGDGVNTQTEPPVEN-GTGPGSPKKGKTSADDYAES 1108 Drosop...
WGS:AAPP:GF11981-PB 1035 GNGSSNAAST--AAAAAAATATAAKPKAPatpPAATSV--GNPAAGDGVNVQSDAPVEN-GGCPASPKKGKSNADDYAES 1109 Drosop...
XP_002016267        1109 GNGNSSANATvaAAAPAAVSANTTKPKAPatpPAATSInpANSAAGDGVATQTDTPAEG-NGSPASPKKGKTNSDEYSEI 1187 Drosop...
WGS:AAPU:GI19561-PB 1038 ANGAAASNAN---PAAAAASTNGVKPKPAstiQEEASA--ANSAGGDGVTSQTDGPANGcSGTPSSPQKGKAGADDYAES 1112 Drosop...
Q7Q974              1020 KKTSSTANAT--TGAANAVTNNATNGNIVan--------aGSNGTGNNVITATNGAANGsLPNGTAVKENRSKWDEYCEG 1089 Anophe...
ETN57947             968 VKKSTGSSSTvaTGSNGSGANNGG----------------GSPSCSSSEANGAEGAANT--------KENKAKWDEYIEG 1023 Anophe...
3LXU_X              1110 FRDFQCSQIVKCELEXAEKIYNDVVAAHPKHLQANLLLIQNIES-NQLK-SQLPLTFVNAQKT 1170 fruit fly
WGS:AAQB:GK21633-PB 1109 LRDFQCSHIVKGELELAEKIYQEVVAAHPKHLQAHLLLIQNIES-NQLKpNQLPLAFALGKEQ 1170 Drosophila willistoni
WGS:AAPP:GF11981-PB 1110 LRDFQCSYINKCELEMAEKIYGEVVAAHPKHLQAHLLLIQNIES-SQLK-AQLPLTFANAQNS 1170 Drosophila ananassae
XP_002016267        1188 LRDFQCTHIVKCEPEMAEKIYNEVVEAHPKHLQAHLLLIQNIEA-AQLK-SAFPLTFTNGQKS 1248 Drosophila persimilis
WGS:AAPU:GI19561-PB 1113 LRDFQCSHIAKCDLEKAEKIYNDVIAAHPKHLPAHLQLIQNIES-SELK-SLLPFAFVAAQQN 1173 Drosophila mojavensis
Q7Q974              1090 LRDYQTAQISKLDAENAENVYQALLKDNPNHLAAHLAMADHFDS-TDLK-QNLPYTFTASFDA 1150 Anopheles gambiae str. ...
ETN57947            1024 LRDFQTAQIAKLDADNANNLYTKLLEEHPNHLAAHLAMVENIESgSDLKtTNLPYAFINSLDA 1086 Anopheles darlingi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap