Conserved Protein Domain Family
DUF3755

?
pfam12579: DUF3755 
Protein of unknown function (DUF3755)
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. There is a single completely conserved residue N that may be functionally important.
Statistics
?
PSSM-Id: 403694
View PSSM: pfam12579
Aligned: 41 rows
Threshold Bit Score: 44.5225
Threshold Setting Gi: 1577005638
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002272798 192 SLQIQDNISLFCQARDNIQAILNDLND-MPEVMRQ 225 wine grape
CDY51645     116 SSKLEENLTLFNKSRDNIMVLVNKLNEnVPDQMkh 150 rape
XP_005845533 167 eFKVGENTELLVAFRDNILAIINAMEG-MGGVMAQ 200 Chlorella variabilis
EFJ27226     173 AGKAQENTDLLAKFRDNLEALLDGMSN-VSGIMSh 206 Selaginella moellendorffii
XP_002504188 589 MKPPRGNLELLARFRDNLMAAKEHLAQ-EEG-ASQ 621 Micromonas commoda
EES13175     236 TLKTEENGDLFLHANNNIRAISERMRE-TLGIMDh 269 sorghum
KQJ85243     251 TFKTEENTSLFLQTNNNIKTILSRMSE-TPGIMSQ 284 stiff brome
XP_004960110 241 TFKTVENADLFLRTSSNIKTILSRMSE-TPGIMGR 274 foxtail millet
Q0J943       200 TFKTGENTDLFFRTNNNFKNILSRMSE-TPGIMGQ 233 Japanese rice
VAH49777     222 AFQAQNNIDLFNRVRRNIDGLLKIMSQ-MPGKMSQ 255 durum wheat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap