Conserved Protein Domain Family
DUF3754

?
pfam12576: DUF3754 
Protein of unknown function (DUF3754)
This domain family is found in bacteria, archaea and eukaryotes, and is typically between 135 and 166 amino acids in length. There is a single completely conserved residue P that may be functionally important.
Statistics
?
PSSM-Id: 403691
View PSSM: pfam12576
Aligned: 25 rows
Threshold Bit Score: 99.2571
Threshold Setting Gi: 219129654
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009543141 162 ERVVLLIKFKG---------------------------------SGYFQAKAKKNKKYqdl-nfTPGKMYLYFYKNIPKL 207 Crocosphaera su...
Q014S6       271 KEVVLLYR------------------------------------MAQPRPNEPSGPS-------GAGPLIIKSFTNIPMA 307 Ostreococcus tauri
XP_001418977 278 KEVVLLYR------------------------------------MARPLDDDAAGPS-------GCGPLIIKSYVDIPMA 314 Ostreococcus lu...
EDQ84757     193 RNVLIYHRgvg-------------------------------vdIARGYFWMEKKPG-------VPPPITVRSFRKIPRA 234 Monosiga brevic...
XP_004995464 290 KEMVVLYR------------------------------------TAEQRDEAAQRPG-------IPPSISVKSFKNIPVA 326 Salpingoeca ros...
XP_005845671 312 RDVVILYRqavsd---------------------------kgpaATEVDVIKEADPKF------MQRNIQLRQFRGIPMA 358 Chlorella varia...
CBJ25706     451 EVVVVYFKRTRrpifktpatlatllragtkignkvrgvekvdaaQDDADEVKA-----------AGLGLQLRVYRGVPLV 519 Ectocarpus sili...
NP_850462    475 EELILLYT------------------------------------KDASEKDDKNKDE-------TRSSLQLEIFERIPIP 511 thale cress
XP_002296116 545 EEVVVVWRPMRnkkrhtiqsnwvdpvk--rwlynaakifdmeeqWPSLKPDEQIKTYIeadvgdGPLPLEIKAFYDVPMA 622 Thalassiosira p...
XP_002184998 501 KEVFVVWRPLSdrrpkmpairppkf------aydladmfdieglLPKKETAPAE----------APHRVEIRAFSDVPMA 564 Phaeodactylum t...
WP_009543141 208 DLDLLFPNIKTSMTWKDKLLFGVPAIGAAVPLVVRAIpnilliivaillllkadsvvdsievDQRKVRDIMPILVATLSL 287 Crocosphaera su...
Q014S6       308 DLEMIFPDKTMSVKLSEMIQNGIAIVLAIGTLIWALI-------------------------KGEVWTKKMQTILLASL- 361 Ostreococcus tauri
XP_001418977 315 DLEMIFPEKTVSVKLQEMIQNGIAIVVAIGTLLWAFV-------------------------TGEIWTKKMQTLLIACA- 368 Ostreococcus lu...
EDQ84757     235 DFEIVLPAVRPKRRSTDVFKILMALGIAIFTIVLKFVqivedel-----------denhtkwEDEPFEQKLRDVLPVLAA 303 Monosiga brevic...
XP_004995464 327 DFEIVLPCQRPTTRALDLVKVLAAVLVALATVATKFWqfyeee-------------keendwHTSTWQERFSEIAPLLII 393 Salpingoeca ros...
XP_005845671 359 DLEMIMPEKKIFVPPKVFVEMAVTLVGGVVAMIAAL---------------------------GRAGKDDVMDLRAVYTA 411 Chlorella varia...
CBJ25706     520 NLNSIAPDKKVEVRPQTALRLDLNTVVGLGLVLANL--------------------------RFDSP-------VLVAAA 566 Ectocarpus sili...
NP_850462    512 DLPVIFPHKKLYFRIIDTVRLDIASILGLTAYFVNY--------------------------KFENISSSPSAFFLDVIA 565 thale cress
XP_002296116 623 NILAVLPKTKLVFRQADAFVFDLVSVVSFLAVVGSV--------------------------KFDSPR-------LDLIA 669 Thalassiosira p...
XP_002184998 565 NLPAVLPSTKLVFRPADAFVFDFISFFSFFVVFGSL--------------------------KFDNPK-------LDLLA 611 Phaeodactylum t...
WP_009543141 288 TMTLGGFAVKQYTKYKSKEIKFQKEVSDTLFFKNLANNSS 327 Crocosphaera subtropica
Q014S6       362 -----GKLGQSYTAVNAAKMRYSGMMAKELIAKSANSQDG 396 Ostreococcus tauri
XP_001418977 369 -----GKLGQSYTAINVARTRYSGMMAKDLIQKSRNAQEG 403 Ostreococcus lucimarinus CCE9901
EDQ84757     304 VG---TYGAKLMVQYQAQTKNYLNVMTKYLYEKAGDTNDG 340 Monosiga brevicollis MX1
XP_004995464 394 VG---TYASKILVQIRTQQATYQNLMTNYLYQRTTDSDDG 430 Salpingoeca rosetta
XP_005845671 412 VSLLGGRAAQVYTSAMTQKLAIEHAMGKMLYERTVGS--G 449 Chlorella variabilis
CBJ25706     567 TVSVVLLVIRTIVGYLNARIRVESFVSRDILDKTMGSNvp 606 Ectocarpus siliculosus
NP_850462    566 VTALVIYATRVVLGYKQTWDRYQLLVNKTLYEKTLASGFG 605 thale cress
XP_002296116 670 FVALGSLAVRTFFRYSNKYARYDLLVNKFLTQKISHRGPG 709 Thalassiosira pseudonana CCMP1335
XP_002184998 612 VLSVSLWLFRTFIRYSNKLARYDLLVKKFLTSKITHRNSG 651 Phaeodactylum tricornutum CCAP 1055/1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap