4LQ8


Conserved Protein Domain Family
120_Rick_ant

?
pfam12574: 120_Rick_ant 
120 KDa Rickettsia surface antigen
This domain family is found in bacteria, and is approximately 40 amino acids in length. This family is a Rickettsia surface antigen of 120 KDa which may be used as an antigen for immune response against the bacterial species.
Statistics
?
PSSM-Id: 403690
View PSSM: pfam12574
Aligned: 3 rows
Threshold Bit Score: 483.825
Threshold Setting Gi: 14916718
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LQ8_A           97 LAEQKRKEieeekEKDKTLSTFFGNPANREFIDKALEKPELKKKLESIEIAGYKNVHNTFSAASGYPGGFKPVQWENHVS 176 
Q9ZD49          103 LAEQIAKE-----EDDRKFRAFLSNQDNYALINKAFEDTKTKKNLEKAEIVGYKNVLSTYSVANGYQGGFQPVQWENQVS 177  Rickettsia ...
LANL:MCE_04250  113 LAEQKRKEieeekEKDKTLSTFFGNPANREFIDKALENPELKKKLESIEIAGYKNVHNTFSAASGYPGGFKPVQWENQVS 192  Rickettsia ...
4LQ8_A          177 ASDLRATVVKNDAGDELCTLNETTVKTKPFTLAKQDGTQVQISSYREIDFPIKLDQADGSMHLSMVALKADGTKPSKDKA 256 
Q9ZD49          178 ASDLRSTVVKNDEGEELCTLNETTVKTKDLIVAKQDGTQVQINSYREINFPIKLDKANGSMHLSMVALKADGTKPAKDKA 257  Rickettsia ...
LANL:MCE_04250  193 ANDLRATVVKNDAGDELCTLNETTVKTKPFTVAKQDGTQVQISSYREIDFPIKLDKADGSMHLSMVALKADGTKPSKDKA 272  Rickettsia ...
4LQ8_A          257 VYFTAHYEEGPNGKPQLKEISSPKPLKFAGTGDDAIAYIEHGGEIYTLAVTRGKYKEMMKEVELNQGQSVDLSQ--AEDI 334 
Q9ZD49          258 VYFTAHYEEGPNGKPQLKEISSPQPLKFVGTGDDAVAYIEHGGEIYTLAVTRGKYKEMMKEVALNHGQSVALSQtiAEDL 337  Rickettsia ...
LANL:MCE_04250  273 VYFTAHYEEGPNGKPQLKEISSPKPLKFAGTGDDAIAYIEHGGEIYTLAVTRGKYKEMMKEVELNQGQSVDLSQ--AEDI 350  Rickettsia ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap