2BP7


Conserved Protein Domain Family
OxoDH_E1alpha_N

?
pfam12573: OxoDH_E1alpha_N 
2-oxoisovalerate dehydrogenase E1 alpha subunit N terminal
This domain family is found in bacteria, and is approximately 40 amino acids in length. The family is found in association with pfam00676. There are two conserved sequence motifs: VPEP and RPG. This family is the alpha subunit of the E1 component of 2-oxoisovalerate dehydrogenase. This is the enzyme complex responsible for metabolism of pyruvate, 2-oxoglutarate, branched chain 2-oxo acids and acetoin. The E1 component is a heterotetramer of alpha2beta2. The homodimerized beta subunits are flanked by two alpha subunits in a 'vise' structure.
Statistics
?
PSSM-Id: 403689
View PSSM: pfam12573
Aligned: 25 rows
Threshold Bit Score: 66.1048
Threshold Setting Gi: 644247788
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BP7_A           5 APLRLHVPEPTGRPGCQTDFSYLRLNDAGQARKPPVDVDAA 45 
Q0ARU0           4 TEPRFHVPAPHVRPGDTPDFSHIHIPPAGEARRPDTSVAGM 44  Maricaulis maris MCS10
WP_011951629     5 PSLRLHIPVPPARPGDAPSFDHLRLSEAGAVRRPDSAAPEA 45  Sphingomonas
WP_012285915     5 PALRLHIPEPQARPGDQPAFDRALIPEPGDTRRPKTAAAEA 45  Caulobacter sp. K31
ELS:G432_01725  11 RPLSLHVPEPRFRPGDIVDFNDFEIPAAGSVDRPAIDADPS 51  Sphingomonas sp. MM-1
WP_025295128    11 PPLRLHVPEPRFRPGDSVDFGDLAIPAAGTAPRPAADAAPD 51  Sphingomonas sanxanigenens
Q1GTH7          18 PPLSLHIPEPRYRPGDTPDFSDIEIPAVEATPRPGEATRPD 58  Sphingopyxis alaskensis
WP_007683515    19 PPLRLHVPEPKFRPGDSADFSDFDIPPAGAQARPDETAQPA 59  Sphingobium
Q2NB18          11 PHLELHVPEPKFRPGDQADFSHIDIGEAGAQPRPDEACDAK 51  Erythrobacter litoralis HTCC2594
Q2G6V7           7 PSLSLHVPEPKFRPGDKVDYSDLAISRAGEQPRPDEQCEAS 47  Novosphingobium aromaticivorans DSM 12444
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap