Conserved Protein Domain Family
TypeIII_RM_meth

?
pfam12564: TypeIII_RM_meth 
Type III restriction/modification enzyme methylation subunit
This domain family is found in bacteria, and is approximately 60 amino acids in length. The family is found in association with pfam01555. There are two completely conserved residues (F and S) that may be functionally important. This family is a bacterial phage resistance protein. It functions in a type III restriction/modification enzyme complex. It is part of the methylation subunit of the complex. It binds DNA and methylates it.
Statistics
?
PSSM-Id: 403680
View PSSM: pfam12564
Aligned: 12 rows
Threshold Bit Score: 59.97
Threshold Setting Gi: 153804136
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BOB002_L21SP2:L21SP2_1102  37 EPMLIKLLLSDKKIKKHFFQDI-EGTFVFDKIKFQKFISNKQFLPDSYTAFKNKVGL 92  Salinispira pacifica
jgi:Bcoa_0567              39 DSNLIKLLLSNEETKKRFFTDI-DGILVFDKVGFGWVINNREFLPDSYTRYKNKIGL 94  Bacillus coagulans 36D1
CDF14745                   37 DAKLIKALFDHEQTRKRFFTDV-DGIAVFDKIGFGWVVNNREFLPDSYTRYKNKIGL 92  Eubacterium sp. CAG:581
ESQ09956                   39 DRDLVKLLLGKPEIKGKFFDEI-EGHWIFNINTFIEYVADKNFLANSYTRFRNKIGL 94  uncultured Desulfofustis ...
tigr:CHAB381_0703          36 DKILIDLLI-NSKFKELFFEKLqNDIWIFKQKTFIDYIDDKNFLLDSYTKFSNKIGL 91  Campylobacter hominis ATC...
P44106                     41 DPTIIGLLLGNDDLKRHFFVEV-NGVLVFKLQDF-RFFLDKHSINNSYTKYANRIGL 95  Haemophilus influenzae Rd...
Q5M4P5                     42 DEALLSKLFEVDFIMQHFVKEV-AGQKLFQIEQLEEAVLYNDYWDTSYTKYENRVGL 97  Streptococcus thermophilu...
jgi:Kole_0062              37 DKGLIKLLLKNKRIKEHFFKDV-DGVLVFDKEKFMKFIDNKEFLPDSYTAFKNKIGL 92  Kosmotoga olearia TBF 19.5.1
BAM33406                   33 NRELLSFLLENAEFRERFFTRV-DSVAVFEKDKFLDFLKLR-MLNKSYTAFSNKIGL 87  Helicobacter cinaedi CCUG...
ADC91484                   38 NENLLTLLLSNKDVKETFFKNV-QGMLVFDKQKFAWFMESKEFLPDSYTAYTNKIGL 93  Mageeibacillus indolicus ...
WP_015024727               37 EPQLIGLLIKSPTFKKHFFTEV-ENILVFDKIKFQRFVNNKSFLPDSYTAFKNKIGL 92  Psychroflexus torquis
WP_117892873               40 rpDLIAKLLTHDGLKRNFFTEI-SGVMVFDKVKFQKFVMNKRFLPDSYTSFKNKVGL 95  Bacteroides vulgatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap