Conserved Protein Domain Family
TagA

?
pfam12561: TagA 
ToxR activated gene A lipoprotein
This domain family is found in bacteria, and is approximately 140 amino acids in length. The family is found in association with pfam10462. There is a conserved GAG sequence motif. This family is a bacterial lipoprotein.
Statistics
?
PSSM-Id: 403678
View PSSM: pfam12561
Aligned: 30 rows
Threshold Bit Score: 92.6927
Threshold Setting Gi: 545471684
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_021708051       673 PAPLQAGVPVLTLLGIYDPSNEFASQVYPVIYSNYGNLFDLPQ--Paeithhlegwqavtglsteqiaqdnwqtmllndq 750  Vibrio a...
EKX81672           528 GHPQQIGVPATTLVGFYDPDLQRAGIAYPALHCAYGVVHPAAS------------------------------------- 570  Pseudomo...
WP_009407994       524 GQPEQVGVPVTTVLGYYDPELGRAGIIYPALHCAWGMTYPGVP------------------------------------- 566  Pseudomo...
QianUST:TMO_a0541  487 PKPVHSGVPVVTLVGFFDPDARFDTFLCP-LYGNYGQVFDLPP--P---------------------------------- 529  Tistrell...
KJY95767          1081 PAPVQVGVPVATILGGYDPDGNN-ALIYPVFHGNYGNIYDLPA--P---------------------------------- 1123 Pseudoal...
WP_067231496       437 AKPAEVGVPVFTLLGGYNPQNPAQTVLYPAFRSNYGNVFALPQsdP---------------------------------- 482  Microter...
KRA37834           492 AKPVKAGIPVFTFLGGYNPANTAQTVLYPAFRSNYGNTFNLPA--P---------------------------------- 535  Nocardio...
EOR05885           514 LKPRLFGVPVYTILGGYDPENQV-GLLYPAARSNWGNVFDLPE--A---------------------------------- 556  Acinetob...
KIV65870           459 RKPRLFGVPVIALLGGYDPETGA-AVLYPALRGNWGQVYDLPP--P---------------------------------- 501  Pseudomo...
ESJ98283           503 ISPTRKGVPVITILGGYDPTPPHNAVIYQYFRGNWGNVFDSIF------------------------------------- 545  Mucispir...
WP_021708051       751 qericlfnytatngdnanfvgtvdqnteqciasedmswhidgkkermasqpndfsllskygegavtytptaaigevplci 830  Vibrio a...
EKX81672               --------------------------------------------------------------------------------      Pseudomo...
WP_009407994           --------------------------------------------------------------------------------      Pseudomo...
QianUST:TMO_a0541      --------------------------------------------------------------------------------      Tistrell...
KJY95767               --------------------------------------------------------------------------------      Pseudoal...
WP_067231496           --------------------------------------------------------------------------------      Microter...
KRA37834               --------------------------------------------------------------------------------      Nocardio...
EOR05885               --------------------------------------------------------------------------------      Acinetob...
KIV65870               --------------------------------------------------------------------------------      Pseudomo...
ESJ98283               --------------------------------------------------------------------------------      Mucispir...
WP_021708051       831 ldkpaashdgagfasgshcqqvpgvkhnnganwayrlgqssviqASMLSQRSCSITV-ERADGSSESIAVANSRIKA--S 907  Vibrio a...
EKX81672           571 --------------------------------------------AAEVDAARCYAWI-SNAKNERLHFVLYGTRLNT--N 603  Pseudomo...
WP_009407994       567 --------------------------------------------EEISLKLHAYAMV-TNAQDERLYFPLRNSRVNP--G 599  Pseudomo...
QianUST:TMO_a0541  530 ----------------------------------------------ASTSGTAWLEI--SGPAGTRRIALGNARHAA--G 559  Tistrell...
KJY95767          1124 --------------------------------------------DLSASDDQCWVSV-SNAAGEQRQIKVSATRHAS--N 1156 Pseudoal...
WP_067231496       483 --------------------------------------------TSTDAARSCWMSV-SYQDGRVEHTTLDAR------D 511  Microter...
KRA37834           536 --------------------------------------------TKTSGTRECWLDI-TLNGGQHREVLLDST------D 564  Nocardio...
EOR05885           557 --------------------------------------------NTAVTQAACWLNI-RSVSG-NKTVGLAPNRMDStnS 590  Acinetob...
KIV65870           502 --------------------------------------------DAAATSRQCWLEV-SFANDRTQRIAVAPTRLG---S 533  Pseudomo...
ESJ98283           546 --------------------------------------------QDSPAEATSYLEItYYDNKPKKYVVLSDKRYNA--K 579  Mucispir...
WP_021708051       908 ESNKFHINLAQQPIPTNVTLSC 929  Vibrio azureus
EKX81672           604 ELNRFHFNVPQSFQATHVRVIC 625  Pseudomonas putida CSV86
WP_009407994       600 ELNRLHLNIPQAFKATYIAVYC 621  Pseudomonas putida
QianUST:TMO_a0541  560 QMNKFHINLRQSDLPVTATFVD 581  Tistrella mobilis KA081020-065
KJY95767          1157 SINQLHFNLEAQFKPTQAVLTC 1178 Pseudoalteromonas ruthenica
WP_067231496       512 GIKQFNINVADAAKPTGAELFC 533  Microterricola viridarii
KRA37834           565 GVKQLNVNVAQSDRPTNASIQC 586  Nocardioides sp. Root614
EOR05885           591 PANKLHVNLAISDQPQHVDLYC 612  Acinetobacter tandoii DSM 14970 = CIP 107469
KIV65870           534 NANKLHVNLAQAEQPVAAALQC 555  Pseudomonas sp. FeS53a
ESJ98283           580 IINKLHVNIAEEDKPKSITLYV 601  Mucispirillum schaedleri ASF457
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap