Conserved Protein Domain Family
DUF3740

?
pfam12548: DUF3740 
Sulfatase protein
This domain family is found in eukaryotes, and is typically between 144 and 173 amino acids in length. The family is found in association with pfam00884.
Statistics
?
PSSM-Id: 403667
View PSSM: pfam12548
Aligned: 32 rows
Threshold Bit Score: 101.661
Threshold Setting Gi: 170065419
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELV11952             515 KPRFVHTRQTRSLSVEFEGEIYDINLeEEEFQVlQPRNIAKRH----------DEGPRGLGGRQVAGGGngdgLLADs-- 582  Chines...
XP_015209250         533 RPRFVHTRSSRSLSVEFEGQIYNIDLqAEDKQGfHPRNISRRHhev----egeGPQMDFEMDDDSa------eMLADd-- 600  spotte...
Q6EFA0               533 RPRFVHTRPARSLSVEFEGEIYDVDLqADDKTPlEPRPISKRHyepe---pgfDSDFGLESDDGSe------eMQSDd-- 601  zebrafish
XP_002589078         460 KCKF-KKRPGRHCVCR--KKVPTVPR-EERRS---QRNFLKDHatqdfrfrfiRSAEETEHQADSEN------PGYKsil 526  Florid...
WGS:AAPP:GF16526-PA  654 QHSHGRRRNKR--------EVFHTEL------PyEMEELLDLHqavd------llaDHSHR------------QKRDvs- 700  Drosop...
XP_002072760         645 NLAHRRMRNKR--------ELYHTEM------PyEMEELLDLHqtvd------lleDQHHR------------SKRQts- 691  Drosop...
KRF82847             655 HQHLGKRRHKRQVAK----EVFHTEL------PyEMEELLDLDqsvd------lltKHGRR------------SKREass 706  Drosop...
EDV93827             687 HQQLGKRRHKRHASDL---EVYHTEL------PyEMEELLDLDksvd------llvKHGRR------------SKREata 739  Drosop...
XP_001867931         401 rgHHRSRRQRRDVPASYE------------------ERLLQADrdmagliriaRSVVELEELEESSHSR----SKRE--- 455  southe...
CAG00671             547 RPRFVHTRPTRSLSVEFEGQIYDVDLqAEDQSGiRRRAISKRHyn------teDPEYDLGSDDGSe------eMLGDd-- 612  spotte...
ELV11952             583 ----------SNAVGPPSTVRVTH------------------------------------------------N-YYNKE- 602  Chines...
XP_015209250         601 ----------TNTIGYPNSVKVTH------------------------------------------------KcYILVN- 621  spotte...
Q6EFA0               602 ----------TNAVGYPNSLKVTH------------------------------------------------KcFILIN- 622  zebrafish
XP_002589078         527 kraanpgkdwSDPFSFPQGDQSFP------------------------------------------------KcFLFPN- 557  Florid...
WGS:AAPP:GF16526-PA  701 ---------gNNSGGNETITQVIQqiqttlealelkfnehdqhstgsssvsssspfgqeeklpktaggkaghRcYVDSVt 771  Drosop...
XP_002072760         692 --------kqSQNTSHEAVAQVIQqiqntletlehkfheneis-----------nstaysgktpktgrraghRcYVDANn 752  Drosop...
KRF82847             707 g------qsvATNSSNDAIALVIQqiqntletlelkfnehelh-----------nrstsflgrgnkflkggaRcYVEESt 769  Drosop...
EDV93827             740 kqnvtninsnSNTTSNDAIATVIQqiqstldtlehkmhs------------------sipvgrggkfqkggtRcYVEESt 801  Drosop...
XP_001867931         456 ----------TSSGGGGQIENVIHelqsslkeieqsveqsa--------------vlrrqnqsegveieagtKcFVTAI- 510  southe...
CAG00671             613 ----------TNAVGYPHSLKVTH------------------------------------------------KcFILMN- 633  spotte...
ELV11952             603 KGVKKQEKLKSHLHPFKEAAQEVDSKLQLFKENRRRKKERKEKKRQRKGEECS 655  Chinese tree shrew
XP_015209250         622 DTVHCEREIYQSSRAWKDHKSYVDQEIEALQDKIKNLREVRGHLKRRRPDECD 674  spotted gar
Q6EFA0               623 DTVRCEREIYQSSRAWKDHKNFVDHEIEQLQDKMKKLREVRGHLKRRRPDECD 675  zebrafish
XP_002589078         558 NTVKCDNVIYESYDAWKQQKQSLDAQIARLKGKLDGLKDIRGHLRKTKPLDGe 610  Florida lancelet
WGS:AAPP:GF16526-PA  772 SKVICSDVVYDDEKTWRTSRAQIDMLIKLLKDKIGKLKELKKQLRENNKHALA 824  Drosophila ananassae
XP_002072760         753 GKVNCSDVIYNDEKTWRTSRNQIDMLIKLLKDKISTLKDMKKQMRESKQQAAA 805  Drosophila willistoni
KRF82847             770 DKVNCSDVIYDDEKTWRTSRNQIDMLIKLLKDKISTLKDMKKQMRENKQQAAA 822  Drosophila virilis
EDV93827             802 DKVNCSDVIYEDEKTWRTSRNQIDMLIKLLKDKISTLKDMKKQMRESKQQAAA 854  Drosophila grimshawi
XP_001867931         511 GRVNCSNVIYEDEHSWKRSRSQIDMLIKVLKNKLNDLKGIKKQLKEHRPSTFH 563  southern house mosquito
CAG00671             634 DSVRCEREIYQSSRAWKDHKSYVDQEIETLQDKIKNLREVRGHLKRTRPEECD 686  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap