Conserved Protein Domain Family
DUF3730

?
pfam12530: DUF3730 
Protein of unknown function (DUF3730)
This domain family is found in eukaryotes, and is typically between 220 and 262 amino acids in length.
Statistics
?
PSSM-Id: 403652
View PSSM: pfam12530
Aligned: 32 rows
Threshold Bit Score: 135.475
Threshold Setting Gi: 1256551899
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEF40946       82 LLELQSALEGT-DEKFVSLFVKGLGFLIRVGfnrnh---gswrFGSPENHPFVRILLCRtevqtELVQQVLLFMAKNMRL 157  castor bean
XP_027302524  493 IPVLIFKLGRPlEPALYRDILYTLPALGVHK------------VCVAQILRTIHTLGST-----PKLRAVTLRMMTALWE 555  mallard
XP_009242667  490 IPVLMFKLGRPlEPILYNDILYTLPKLGVHK------------VCIGQILRVIQLLGTT-----PRLRAVTLRLLTSLWE 552  Sumatran oran...
XP_009301365  492 LPVLMFKLSRVsDPALSLSVLYTLPKLGTHK------------LCIPQVLHVLQTVGSS-----SRLRPVALRLLALLWK 554  zebrafish
XP_001629707  497 LPLLLYKLGKEaNPDLKLQILYTIPELATHK------------LSVAPVLRSVQTLSLS-----PALRSVALRLVCRVWM 559  starlet sea a...
EFX77621      442 LTLLLKKLTTPsNGKTKLAILYHLPSLAIDK------------TCVPRVLQIYEALSSS-----PQLKPVRIKLLADLWK 504  common water ...
EEB15748      277 LCLLFHKLVKEsHPIMQKKYLFCLPSLAVQK------------ENIPLIIGIIESLKKGn---sTIMTPVIIQLYLKLWK 341  human body louse
EDW01062      479 LMTYIFKLAHEhNPELQLELMRGLPSFAVSK------------DNVPMILNTIRNLSTDn-------GTFCVDLYLRLWR 539  Drosophila gr...
KAE8278840    428 IPVLLFKLGKEkNPFQAHAVLNCLPNLGTHK------------LCVPMVLQTLQMLASA-----PKLRAVAMRLMTVLWK 490  large yellow ...
CAF93350        6 IPVLLYRLGRDrNPEVVHALLYCLPTLGTHRrlqlakvlallqLCIPLLLQTLSTLAAA-----PKMTAVAMRLLTALWK 80   spotted green...
EEF40946      158 GMVKVCEFLKPLAVFsilsipfsNSTSSLFARQLIPSMASFCCSlpeealpvlklLMGCLKYLPHKNSDVgilvyrildc 237  castor bean
XP_027302524  556 RQDRIYPELQKFLATs------dVPSLAVDKDAQWEKLIAKAAC-----------IRDICRQRPYQHGAD---------- 608  mallard
XP_009242667  553 KQDRVYPELQRFMAVs------dVPSLSVGKEVQWEKLIAKAAS-----------IRDICKQRPYQHGAD---------- 605  Sumatran oran...
XP_009301365  555 KQDRVYPDLQRLMCQl------dKSSVVMGKDTQWEQILARAAC-----------VRDICRERPYQHGGD---------- 607  zebrafish
XP_001629707  560 KQNRVFPHLHKALLG--------AKAGIRDKGLLMEVNVSVAAT-----------IRDICKHRASQHGGD---------- 610  starlet sea a...
EFX77621      505 IEDRVYPFLEKVLN--------------ADQQQTEEFLIAKATA-----------IDIICMNRSDKYGAE---------- 549  common water ...
EEB15748      342 VDNRTYSYLHKMLH------------EYPSENLKLELNLSKAIA-----------LKEICCVAPHFHGKS---------- 388  human body louse
EDW01062      540 VEVRTYPFLLKQIA-----------QPLPDSDKRWETEIARTHA-----------MREICQEKPTLHGSE---------- 587  Drosophila gr...
KAE8278840    491 KQDRIYPELQRLLGQq-------DSRVVVGRDAQWEQVLARAAC-----------LRDICRERPYQHGGD---------- 542  large yellow ...
CAF93350       81 LQDRVYPELQLLLG---------RDSQVVGRDARWEQALARAAS-----------IRDICRQRPYQHGGD---------- 130  spotted green...
EEF40946      238 yyflecVVDAYTVVLrs-lVQTGLLVT--KAQLFGVELSETILSLlthvhgrsggaEpIVELVKRLIVIQKDLSLCYIPE 314  castor bean
XP_027302524  609 ------MLAAISQVL----NECTKPDQa-SPAAIVLQGLQALCEA-----------E-VVCIRSTWNALSPKLSCDTRPL 665  mallard
XP_009242667  606 ------MLAAISQVL----NECTKPDQa-TPAALVLQGLHALCQA-----------E-VVCIRSTWNALSPKLSCDTRPL 662  Sumatran oran...
XP_009301365  608 ------MLAAIRDTL----LQFSRKDQa-TPVALALQALQELCRA-----------E-VVDICSTWKALSPKLLSDTRPL 664  zebrafish
XP_001629707  611 ------MLGILSNLInehtGKMAGDEKsaVVIVLSLQGIKALCEA-----------E-VVDLCTVWRVLAPKLSDDRRPA 672  starlet sea a...
EFX77621      550 ------LLSVISDLLnsslGKLTASSA--TIATLSLRSLVSLCRA-----------E-VVDLKSVWDLLAPKLNQDHRAS 609  common water ...
EEB15748      389 ------VIGLLSKIL----NESEDEVHg-SASALSIEAVIELCKA-----------C-VIDISGTWDAIRPKLSIDKRPK 445  human body louse
EDW01062      588 ------LLPHLSNTL----NSCTDESGd-LATSLALDAIYALCDS-----------H-TVNIASTWQALGSKFRSEQRPQ 644  Drosophila gr...
KAE8278840    543 ------MLAAITLTL----NQCTKPDMa-TPAALALQGLQELCRa------------eVVDIISTWRSLGPELSCDSRPL 599  large yellow ...
CAF93350      131 ------MLAAITLTL----SQCSSPEMa-VPAAIALHGLKELCCA-----------E-VVDILSTWRSLGPRLSCDQRPL 187  spotted green...
EEF40946      315 LSSVILSSFAILIQSELEHEQLSLLKLVIFLVKW-KGENECAfDRATCALSEEV 367  castor bean
XP_027302524  666 ILKALNELFALVPSLTVNTNEYEKFKAQVISFLW-KNTQNKD-AIVAVSAYKAl 717  mallard
XP_009242667  663 ILKTLSELFSLVPSLTVNTTEYENFKVQVLSFLW-THTQNKD-PIVANAayrsl 714  Sumatran orangutan
XP_009301365  665 VLKATAELLALVPDLNVKTEEYEKFGSEAVGVLW-GYALSQD-SVVASQGFKAl 716  zebrafish
XP_001629707  673 VMKCLCELFALVPRLATDTQQYQEFKQEVLGFLW-RMTRYRT-AWVSGAAFSAL 724  starlet sea anemone
EFX77621      610 VVSEMCNLLALTAELRIDNEEYDEFIHQAILTLF-RVSLSTNvTEVHSLALRSl 662  common water flea
EEB15748      446 VIKALCSFFGEIPNIHIPEKKFDQLKEDIIPLLW-NFTFLNN-DEIAEEAFRAl 497  human body louse
EDW01062      645 TLKSLYHLFGLVPLLQTPTLEYEKLADDALEQLWqAVSRPNTdATHVRNALVAL 698  Drosophila grimshawi
KAE8278840    600 MVKAIAELLALVPQLNVKSEEYEKLKEEVVSFLW-NYAASKD-SEVASCGYKal 651  large yellow croaker
CAF93350      188 MVQATAKLLALVPQLSVPTEEYQKLKEEAVSLLW-NYAASQD-ADVASCGYEal 239  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap