Conserved Protein Domain Family
MDM10

?
pfam12519: MDM10 
Mitochondrial distribution and morphology protein 10
MDM10 is a family of eukaryotic proteins that forms a subunit of the SAM complex for biogenesis of beta-barrel proteins, though not porins, into the outer mitochondrial membrane.
Statistics
?
PSSM-Id: 403647
View PSSM: pfam12519
Aligned: 57 rows
Threshold Bit Score: 417.776
Threshold Setting Gi: 684159660
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_014169245   1 MREFFNYFLESFRDATGW-SRDNGYSTLNETAN-ELLNFHSPRGLRMTLASLATPHFSTSYTLGTI------GAVDGSIS 72  Grosmannia clav...
CCF60433       1 MLDYMDYIVRAFEKSTNW-NRDSSYENITSTSR-ALLEFHIPKTFKFQTSNRSTTNTFSTLEIDRN------NKINGSLT 72  Kazachstania af...
CCC70664       1 MLDYMEYVVKTFHQLTNWnPQANSYEHLTDTSE-ALLDFTIPNSFKFQLSNNSSPYTYNTLEITARqnnrhpQRINGYLT 79  Naumovozyma cas...
XP_003671683   1 MLNYMEYVARSFQNATNWnPSSNSYEYITETAR-SLIDFQIPDSFRFQLSNNSSNVSYNTLEVTTKqnnlqnKKVHGFLT 79  Naumovozyma dai...
A7TNL0         1 MIEYMNYVIKSL-------QSNNDYEHLTLSSR-SLLNFKIPNAFKFQLSNKSTPYTYNTIDISTN------KVINGSIT 66  Vanderwaltozyma...
CCE94206       2 MLDYMDYISRAFEQSTNW-NRDNSYANITATTS-ALIDFSVPSAFEFQVSNASTPFTFNTMRVSTR------NVFNGSLT 73  Torulaspora del...
C5E1U4         1 MLDYMDYVQRQFEKSTDW-NYDNSYANILASSR-NILDFPVPNQFKFQLSNNSTPHTFNTMEVFSR------KIFNGSMT 72  Zygosaccharomyc...
CDF91704       1 MLDYMDYVIRQFEKSTNW-NYDNSYANITASSR-HVLDFPVPNQFKFQISNKSTPYTFNTMEIFTK------KIFNGSMT 72  Zygosaccharomyc...
P18409         1 MLPYMDQVLRAFYQSTHW-STQNSYEDITATSR-TLLDFRIPSAIHLQISNKSTPNTFNSLDFSTR------SRINGSLS 72  Saccharomyces c...
CCK70212       1 MLDYMDYVQRTFETATGW-HRDRGYANVGSGGAlACSSSRCPSGSSCRLHTRATRHSFNTLDLASW------GNVSGALT 73  Kazachstania na...
XP_014169245  73 YLYSSVP-LSNAVAQSASISLPTLLRSFRQ------LQPglapsspyaasltppplplesifpfassvsaaavattettp 145 Grosmannia clav...
CCF60433      73 YLYTDADnVEKIVKSSSQVLLQDATETYRH------IQP----------------------------------------- 105 Kazachstania af...
CCC70664      80 YLYTNVKnLHDAIHNSNDISLQDATQTYKH------VQPs---------------------------------------- 113 Naumovozyma cas...
XP_003671683  80 YLYTNMEnLHEIILSSSKINLQDATQTYKH------IHPsyyk------------------------------------- 116 Naumovozyma dai...
A7TNL0        67 YLYTDAKgLDKLIKDSHNINIQSIVETYNHhcktlnI------------------------------------------- 103 Vanderwaltozyma...
CCE94206      74 YLYTDADnLEKIVSDSGSIDLQNVTETYRY------FQPf---------------------------------------- 107 Torulaspora del...
C5E1U4        73 YLYTDAEnMDKLVHDSNSISLQDVTDTYRY------VQP----------------------------------------- 105 Zygosaccharomyc...
CDF91704      73 YLYTDADnMDIFVQNSNSTTLQDVTETYRY------VQP----------------------------------------- 105 Zygosaccharomyc...
P18409        73 YLYSDAQqLEKFMRNSTDIPLQDATETYRQ------LQPnlnfsvssa-------------------------------- 114 Saccharomyces c...
CCK70212      74 YLYTDCAaVEELVGGSEAVRLQHATETFRD------VAGkhpttyhdaakqqndaqetq--------------------- 126 Kazachstania na...
XP_014169245 146 assdppsssllsndylvpaaeRLAHLVHEARRLVDKPVLLCGRLYLPRSMLEAYICKRLATSLQLQLRAVSDAk---LPN 222 Grosmannia clav...
CCF60433     106 ---------------------FFSRQLDDITHAFEPKSLYYGRIYYPKSTLEAMIIKRFNVNTQLVVKCISNM----YSD 160 Kazachstania af...
CCC70664     114 ---------------------FNTKKKSIVDHEGENASLYYGRIYYPTSDLEAMVMKRLKRNSQLTFKWLSSP----INN 168 Naumovozyma cas...
XP_003671683 117 ------------------rrrGHNYFDNGIEKSKDNLSLYYGRMYYPSSDLEAMIIKRLNRNNQMTLKWLSSS----AYN 174 Naumovozyma dai...
A7TNL0       104 -----------------------------NKQNVDFKSLYYGRMYYPNSHLEGMIIKKFTTNTQVVLKWVSSF-----NS 149 Vanderwaltozyma...
CCE94206     108 --------------------yNNHKLAAPTDGKTVGKSLYYGRMFYPNSNLEAMLIKTLDPHKQLKIKWLSTF-----DD 162 Torulaspora del...
C5E1U4       106 ---------------------YY-THKPSSNGDNHVRSLYYGKMSYPSPNLEAMLIKRLNESTQLTLQCVSSF-----NG 158 Zygosaccharomyc...
CDF91704     106 ---------------------YH--SHAHASSLNHMKSLYYGRMSYPCPNLEAMLIKRLNETTQLTLKCVSSF-----NG 157 Zygosaccharomyc...
P18409       115 ------------ntlssdnttVDNDKKLLHDSKFVKKSLYYGRMYYPSSDLEAMIIKRLSPQTQFMLKGVSSF----KES 178 Saccharomyces c...
CCK70212     127 -lepedanygsdpvalhaspaASHPAAQDARQCAWPHSLYYGRIYYPSSTLEAMIVRRCTPFSQLVVKCISSAtpapTPQ 205 Kazachstania na...
XP_014169245 223 GGTVLGILQYDC--GTYGLEGLASSDGGLLGVRGLYNFgdgngsgsssYGNNGNGSGSGSNSngsgdrssshnpddsaer 300 Grosmannia clav...
CCF60433     161 MNIMLLNWQRTK--GQNLQEFVVSSNGLLCGYRVLHNF----------ISSPSKFNNSLYNN------------------ 210 Kazachstania af...
CCC70664     169 LNILTIYWQLKTrqDRNLHEFIYSTNDSLCGYRVLHNF----------VSGSSKFNNSLYNN------------------ 220 Naumovozyma cas...
XP_003671683 175 FNIMTLYWQNKSrqNRNFQEFIFSTNDYLCGYRILHNS----------LSTSSKFNNSLYNN------------------ 226 Naumovozyma dai...
A7TNL0       150 CNIITGYFQKYG--KRNFQELIVSSNDFLCGYRFLHNF----------IEQPSKLNNSLYNN------------------ 199 Vanderwaltozyma...
CCE94206     163 FNILTCYWQRDT--GRDSQEVIFSTNDLLCGYRFLHNF----------IGKPSKMKNSLYNN------------------ 212 Torulaspora del...
C5E1U4       159 FNILTGYWQHDT--GRNRHEVIMSTNDLLCGYRYLHNF----------LGTPSKLKTSLYNN------------------ 208 Zygosaccharomyc...
CDF91704     158 FNILTGYWQHDT--GKNRHEIIMSTNDLLCGYRFLHNF----------VGTPSKFKTSLYDN------------------ 207 Zygosaccharomyc...
P18409       179 LNVLTCYFQRDS--HRNLQEWIFSTSDLLCGYRVLHNF----------LTTPSKFNTSLYNN------------------ 228 Saccharomyces c...
CCK70212     206 FNIATLYWQRDK--DHSFQEWILSSNDALLGYRVLHNY----------VGGGSKFNNSLYNN------------------ 255 Kazachstania na...
XP_014169245 301 lhgGRFSAGGEIYYGTLNKSGGISLGARFATLPSNSGTPLTATMTINPLMGNISASYAVVAREYCSLATKFDFNVYSYES 380 Grosmannia clav...
CCF60433     211 ---SSMSLGGEVWLGLSTLTPGCSTTLRYCTNSANTGRPLTLTFSWNPLFGHISSSYTAMTTSNSTISAKYDFNLFSIDS 287 Kazachstania af...
CCC70664     221 ---SSLSVGGEVWLSLKSHNPGGSTSIRYCTHSANTGRPLTLTFSYNPLFGHISSTYAAKTGLNSTFCTRYDFNIYSIDS 297 Naumovozyma cas...
XP_003671683 227 ---STLSIGAELWLSLKSMNPGCSTSLRYCTHSANTGRPLTLTVSYNPLFGHISSSYSAKTSLSSTFCTRYDFNIYSIES 303 Naumovozyma dai...
A7TNL0       200 ---SYISLGGEFWLAISTLSPTCATTLRYCTHSATTGRPLTLTLSFNPLFGHLSSTYSAKTSSNSAFCVQYDFNLYSIDS 276 Vanderwaltozyma...
CCE94206     213 ---SSLSLGAELWLGLITLSPGCSTTLRYCTHAPNTGRPLTLTLKWNPIFGNLSSSYSAKTSSNTTVCAKYDFNLYSIDS 289 Torulaspora del...
C5E1U4       209 ---FSLSLGGEVWLGIVTLSPGCSTTLRYCTHSPTTGRPQTLTLTWNPLFGHISSTYTAKTSSSSTFSTKYDFNLYSIES 285 Zygosaccharomyc...
CDF91704     208 ---SSLSFGAELWLGIITLSPGCSTTLRYCTHSPNTGRPLTLTLTWNPLFGHISSTYTAKTSSSSTFSTKYDFNLYSIDS 284 Zygosaccharomyc...
P18409       229 ---SSLSLGAEFWLGLVSLSPGCSTTLRYYTHSTNTGRPLTLTLSWNPLFGHISSTYSAKTGTNSTFCAKYDFNLYSIES 305 Saccharomyces c...
CCK70212     256 ---SVLSFGFEAWLGLVSLNPACSVSARYATHAANTGRPLTLTVSWNPLFGHVSSTYAARTTTNTAFTAKYDFNIYSIDS 332 Kazachstania na...
XP_014169245 381 EWAVGMELWSKRRLAGLVADDLDVESDSQRERGVAVASSSSTGTAAIYTGAATSTAaapttaiapiktapftkapfktap 460 Grosmannia clav...
CCF60433     288 NLSFGCEFWKSGSKINDPDLESSFENVATFETTTSNTSDAGPVTTRHYSTVENDVLslsphee----------------- 350 Kazachstania af...
CCC70664     298 NLTFGWEFWKNNSDNSKLKEPDTNVNSLSGNSS----------LEVSPLINTSQQKlln--------------------- 346 Naumovozyma cas...
XP_003671683 304 NLSFGWEFWGTGKQKESLLPPNTINNTSIVPNMAILNNVNGTIPNNISDDGIILDEhfsegtrksqilptmel--sptts 381 Naumovozyma dai...
A7TNL0       277 NLSLGCELWKQNELIQNVSQEKSKKQEIQVPPNFYNNNSNDA-KQKRILNDLNT-------------------------- 329 Vanderwaltozyma...
CCE94206     290 NLSFGVELWRRGNSAKAMSQYQDVSQTFGKDENLMYHHLVPDLSQEQASPQTRKDLvekqql------------------ 351 Torulaspora del...
C5E1U4       286 NLSFGCEFWRRGYQESSPQLQEQINGHASEPKDRIMYYHMMAPDSRNSISPRANSPqerql------------------- 346 Zygosaccharomyc...
CDF91704     285 NLSFGCEFWRSGSEEKPYEGDNHQGDSKMYHHMMTSEKDLKAFSNSVPDKNPKADSqqekql------------------ 346 Zygosaccharomyc...
P18409       306 NLSFGCEFWQKKHHLLETNKNNNDKLEPISDELVDINPNSRATKLLHENVPDLNSAvndipstldip------------- 372 Saccharomyces c...
CCK70212     333 NLSFGCEIWRRGRQTGLPGASVPEKRPARGVPIEWPLDLVHPSVQTQKLLDDLTH------------------------- 387 Kazachstania na...
XP_014169245 461 staatgsssgkEASPNQTPNPALPVFPERSFQAKLEwrlddpavespgvaatvakhddkplgrksaDDEYQGVLKARLD- 539 Grosmannia clav...
CCF60433     351 ----rllndltDTFSESLQKMDKEKSIIERFKNKFR------------------------------NENFTQVWKFATSl 396 Kazachstania af...
CCC70664     347 --------dltYTFSSSLEKIDKEKTAIEKFQKKIN------------------------------ESNFTNVWKFSTSl 388 Naumovozyma cas...
XP_003671683 382 esqqkllqdltYTFSSSLEKIDKEMTLIDKFQNKFE------------------------------MTNFTSVWKFSTSl 431 Naumovozyma dai...
A7TNL0       330 ------------TFESSLKKIDKERAVIENFETDLY------------------------------NKDFTSVWKFSTSl 367 Vanderwaltozyma...
CCE94206     352 ------lndltTAFSSSLRKIDREKTMIEEFQNNLH------------------------------HANFTSVWKLSTSl 395 Torulaspora del...
C5E1U4       347 ------ledltIAFSSSLKKIDKEKSMIEQFENRIN------------------------------QSNFTSVWKLSTSs 390 Zygosaccharomyc...
CDF91704     347 ------lddltIAFSSSLKKVDKEKSVIKKFENKVS------------------------------DSTFSSVWKLSTSl 390 Zygosaccharomyc...
P18409       373 vhkqkllndltYAFSSSLRKIDEERSTIEKFDNKIN------------------------------SSIFTSVWKLSTSl 422 Saccharomyces c...
CCK70212     388 ------------TFSASLQKLDEERSIIEQFENNFN------------------------------AANFTNVWKMSTSl 425 Kazachstania na...
XP_014169245 540 QNLKIGLLWEGRIQSLLFSLGSVVDlnkl---------------------------dqpFRTLGLQIQFS 582 Grosmannia clavigera kw1407
CCF60433     397 RDRNLKILWEGKFREFLISAGTELVfsrdvliskgfd----------dsnnaqnnnskiPAKFGIKIQYS 456 Kazachstania africana CBS...
CCC70664     389 KDKNLKIKWEGKFKGFLLSAGTELYstssiiqdingqtn-------fkhqknervmplyPGKFGFQLQYS 451 Naumovozyma castellii CBS...
XP_003671683 432 RDKNLKAKWEGKFRGFLVSIGTELFtttpepktnsskpa-------fkhennnsvlplhPAKFGIEIQYS 494 Naumovozyma dairenensis C...
A7TNL0       368 RDKNLCILWDGKFKGFLLSAGTELIrintnnenn-----------------sqslvkfyPAKLGLQLQFS 420 Vanderwaltozyma polyspora...
CCE94206     396 RDANLKVLWEGKFKGFLISAGAEVSkaspllqss-----------------sseklpsyLSKFGVQLQYS 448 Torulaspora delbrueckii
C5E1U4       391 KDKNLRLLWEGKFKGFLLSAGTEFCktnprneinev-------------pstenkltfyPNKFGIQLQYS 447 Zygosaccharomyces rouxii ...
CDF91704     391 RDKNLRVLWEGKFKGFLLSAGADFCnndpkaeltel-------------qtdekklsiyPKKFGVQLQYS 447 Zygosaccharomyces bailii ...
P18409       423 RDKTLKLLWEGKWRGFLISAGTELVftrgfqeslsddekndnaisisatdtengnipvfPAKFGIQFQYS 492 Saccharomyces cerevisiae ...
CCK70212     426 MDRNLRVLWECKFKGFLLSMGTELLaspssdqvan---------------trkpfpieiPKQFGIMVQYS 480 Kazachstania naganishii C...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap