Conserved Protein Domain Family
ERbeta_N

?
pfam12497: ERbeta_N 
Estrogen receptor beta
This domain family is found in eukaryotes, and is approximately 110 amino acids in length. The family is found in association with pfam00104, pfam00105. There is a conserved IPS sequence motif. There are two completely conserved residues (Y and W) that may be functionally important. ERbeta binds estrogens with an affinity similar to that of ERalpha, and activates expression of reporter genes containing estrogen response elements in an estrogen-dependent manner. ERbeta acts as a transcription factor once bound to its ligand and it can dimerize with ERalpha.
Statistics
?
PSSM-Id: 403630
View PSSM: pfam12497
Aligned: 15 rows
Threshold Bit Score: 141.459
Threshold Setting Gi: 525344751
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007473054  36 SP-APYNCSQAVLPLEHSPLYIPSSYVEGRHEYSAMAFYSP-TVMNYSIPSNANDSEGGAVRQTTSPNILWPTPGHLSP- 112 gray short-tail...
XP_017204881  31 SP-ASYNCSQSVLPLEHGPLYVPSSYVEDHHEYPAMTFYSP-AMMNYSVPSGASEADRGPGRQPTSPDVLWPTPGHLSP- 107 rabbit
XP_016846689  37 SPaIPFSCSPSALTVEHSPIYIPSSYMENRHDYSAMAFYTPaAMMNYNIPGNFSDSESTALRQTASPSMLWSGPGHISP- 115 green anole
XP_002200631  36 SP-VPYNCNQSTLTAEHSPLYIPSSFMENRHEYSTMAFCSP-AMVNYNIGSNFGDAEGVTARQTSSPSALWAAPGHLSP- 112 zebra finch
XP_005986456  36 SP-VPYSGNLSTLPVEPRKICITSPYLENRHDFTTMAFYSP-AILGYNVPAGVGESDNMAVSQSLSPTMLWPPAGHISP- 112 coelacanth
Q7ZU32        28 SP-IFN-SSSPSLPVENHPICIPSPYTDLGHDFSTLPFYSP-ALLGYSTSP---LSDCSSVRQSLSPTLFWPPHSHVSS- 100 zebrafish
NP_001266703  28 SP-ILGSSSPGLSHETSQPICIRSPYTDLGHDFTTIPFYSP-TIFSYGGPS---ISECSSVHQSLSASLFWPSHGRVGTp 102 Nile tilapia
OXB59801      36 SP-VPYSCNQSALTTEHSPVYIPSSYVENRHEYSAMAFCSP-AMMNYNIASNFGDSESASVRQTSSPSVLWSAPGHLSP- 112 scaled quail
AAI71194      34 SS-VPYS---GTVPMDQSPMYTPSSYLDSRHDYPSITFCSP-SLINYNVPG--SDSESSVLRQTVSPGLLWTSPDHMSP- 105 tropical clawed...
NP_001254665  12 SP-SSYNFGQSILPLEHGPIYIPSSYVESHHEYPAMTFYSP-AVMNYSIPSSVTNLEEGPGRQITSPNMLWSTPGHLSP- 88  white-tufted-ea...
XP_007473054 113 ITLHC-QSSLLYAEPQKGPWCEARSVEHVLPgNNRE 147 gray short-tailed opossum
XP_017204881 108 LAIRC-QSSLLYPEPQKPSWCEVRPLEHTSP-VNRE 141 rabbit
XP_016846689 116 LTLHC-QSSVLYAEQPKSPWCEARPMDHVLP-MHRE 149 green anole
XP_002200631 113 LSLHC-QSSLLYPEQPKSLWCEARPMEPVLP-GSRE 146 zebra finch
XP_005986456 113 MALHC-QPSLMYAEPSKDPWSEDRLIEQNLSlNSRG 147 coelacanth
Q7ZU32       101 LTLQQ-QSRLQQNHATSGTWTEHTPHDHVEEeNSKP 135 zebrafish
NP_001266703 103 ITLHCpQGRSQQGQSAQTPWDSVIT-------TSKS 131 Nile tilapia
OXB59801     113 LTLHC-QSSLLYAEQPKSPWCEARPLEPVLP-VTRE 146 scaled quail
AAI71194     106 VTLHC-QSSLLYTEAPTSPWFEAKSEEHILPl-sRE 139 tropical clawed frog
NP_001254665  89 LAVHH-QLSHLYAEPQKSPWCEARSLEHTLP-VSRE 122 white-tufted-ear marmoset
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap