Conserved Protein Domain Family
DUF3703

?
pfam12487: DUF3703 
Protein of unknown function (DUF3703)
This family of proteins is found in bacteria. Proteins in this family are typically between 113 and 135 amino acids in length.
Statistics
?
PSSM-Id: 403623
View PSSM: pfam12487
Aligned: 43 rows
Threshold Bit Score: 116.93
Threshold Setting Gi: 504984755
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12HS2              3 KKQQQGYDLYYRSAKKNLKKGNYQQAMTDLGYCHILSKNSYLQHLKIHWRMLLVGFKNGNLKEVRVQMFRcfMAFATAPM 82  Shewanella...
jgi:Pnap_4869       6 iRIKPSVQREIAAADAAQARGHFSTSFEHLERAHVLGQAATAEHVRVHWHMLRFALRNSLHGEAFGQLWR--LVAASIFT 83  Polaromona...
WP_013783942        5 QAAKPYVEEKLRDAQHAFTNQDEETEFKALEDAHVIGQHSTFHHTRVHYEMLKFGLKRKDTKEVFGQLFR--LIGAVTKT 82  Alteromona...
SDU:GNIT_3608       5 KLTRHFIKQKMNQYELALAQGEHKKAFSMLEDAHVIGQRSTYFHCLVHYKMLRHGLRYRDFREVFGQVVR--LVGAFTKT 82  Glaciecola...
Q15U94              5 KAVKPHIDSKLTDYLDAMSNNNERQAFAALEDAHVIGQHSTYYHCLIHYKMLRHGFLNKDWRAVFGQVIR--IIGAATKT 82  Pseudoalte...
BAJ03238           15 KNIKPYVETELNLARKAYAAGHYSHAFKYLENAHVIGQESTYYHVKVHYIMLFWALRQRNLGELLGQAFR--VVGAATKT 92  Shewanella...
Q15SV2              7 KNIRFVVLKELARALDARRKGNYLQEFAHLEHAHVLGQNSTYWHTKVHCLMFAWAKRQADKKECIGQLLR--IVGAVSKT 84  Pseudoalte...
jgi:Mpe_A2354     289 AAVATVFAASLSDGYAALDAGDLQAAYATFERAHVLGQTRTMRHVCTHIAFWRWARRAGDWREALGQLLR--IPAALLFT 366 Methylibiu...
jgi:Pmen_4224       3 MELQKAIDQAFAQALLELQARRASEALVWLERAHILSQRRPLLHARSHWLMLRAGWQLGDGREVLGQMPR--MVAAL--- 77  Pseudomona...
mgcchina:PST_0665   3 AALQLAIEQAFQQAEHAMQERRNTDAFEWLERAHILTQRQPLLHARSHWLMLTLGWQIGDYREVAGQIPR--IFAAL--- 77  Pseudomona...
Q12HS2             83 LAGT--QPNGNPGDSNHGFFDKLTIPEILQEYF 113 Shewanella denitrificans OS217
jgi:Pnap_4869      84 APGL--VPEGNTGGADVSGFRRMPIAQDLQQAL 114 Polaromonas naphthalenivorans CJ2
WP_013783942       83 AVGL--LPEGNTGGANVSPFKPIPLSPANKVIL 113 Alteromonas naphthalenivorans
SDU:GNIT_3608      83 AIGL--VPIGNTGGANVSPFKRLPVSKANQEVL 113 Glaciecola nitratireducens FR1064
Q15U94             83 AIGL--VPKGNTGGTNISPFKRLPVSTKNQAIL 113 Pseudoalteromonas atlantica T6c
BAJ03238           93 AFGL--VPSGNTGGANVSPFKVMPISPKHANYI 123 Shewanella violacea DSS12
Q15SV2             85 AVGA--LPQGNTGGSNISPFKSLPLQERHARAI 115 Pseudoalteromonas atlantica T6c
jgi:Mpe_A2354     367 WVW---MPRGNTGGARVGALRSLPIPDDLRPYL 396 Methylibium petroleiphilum PM1
jgi:Pmen_4224      78 LFSRlwVPSGNTGRARVSALRPMPISEELRRLL 110 Pseudomonas mendocina ymp
mgcchina:PST_0665  78 LFSKiwVPLGNTGRSRVSAFKPMPVPEELQALL 110 Pseudomonas stutzeri A1501
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap