Conserved Protein Domain Family
VasL

?
pfam12486: VasL 
Type VI secretion system, EvfB, or VasL
EvfB or VasL is a domain found on many Gram-negative proteins with an ImpA_N domain at the N-terminus. These proteins are expressed from the pathogenicity locus that forms the bacterial type VI secretion system. The exact function of VasL is not known. One E.coli member is annotated as being EvfB, though the E.coli equivalent of ImpA would be expected to be EvfG. It is possible that in many bacteria what is a single protein in one species, eg E.coli, is a fusion of two genes in others, which would explain an ImpA at the N-terminus and a VasL at the C-terminus.
Statistics
?
PSSM-Id: 403622
View PSSM: pfam12486
Aligned: 12 rows
Threshold Bit Score: 171.051
Threshold Setting Gi: 1523817381
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rahaq2_4598     303 MQQQTRQLATLSPRWAQDTGSHLVSQALILWPDnpATAALAKSWTQQLNANAVPLENLSGWQQANTQLQQLADKLNGLDE 382 Rahnella...
WP_015958620        303 TQRQLGELARLAPDWAVSYGDQLVHQALIRWPD--QAQPLAQQWRQQLSAGALPAENLTGWSEGMQQLQRLADQLNALDE 380 Klebsiel...
Q7MZS6              309 SRAQLTNLTTLPAFWPLSYGSQLLQQLRTLWPAsqAVQDMQNQWLHQREAAALPMQSLENYHLAQLRLQHLTERLDALDE 388 Photorha...
Q6D1L5              326 YQAQLEQVKNASPFYLYQYGNGLKNVMQQLYPDslAVKEMERQWQITLERQQGDEPKTLGYEQARARVNDTLQQLLELER 405 Pectobac...
WP_024911326        291 YSEQLGTLENLSPLAGLRTAELSVAMARQLWPSnpNQVAESQRWERLLQARMGNNAAGSGYFQLQRRLQALSEKLLEQEQ 370 Chania m...
Q74PG2               24 YGEQLSTLENLSPLFVLNTADQSVAMARQRWPSdpSQVAESQRWARLVEARIGLAGTDSSYFQLQQRLHALSEKLLEQER 103 Yersinia...
CAR41711            284 YEYHLALLEKRSPLSNLRLIDTMQEKAKNAWPTdaEQIYFTRNWQNLYQTRLENMPINDSWSETATLLQQLSNKIVQQER 363 Proteus ...
WP_012986890        289 YQGQLDRLAETPLLATWDAARTLTGTAAQQWPDsaEQKNATHQWTQAMTARIDSIPLKGSWHTTRDQLQQLADKILLQER 368 Xenorhab...
CBJ92560            291 YAQQLERLAETGPLATWEAARTLTDTAEQLWPSapAQRQATRQWEQAMTARIDSAPLKGSWNTTRDQLQQLADKILLQER 370 Xenorhab...
goetting:EBL_c12050 314 TGQQLAWLDKLPPDWRLARSQQLVDQAQILWPE--QAKPLIQKWQQQLNAATLPPEYLNGWHQGMTTLQQLSDKLNRLDV 391 Shimwell...
WP_013200461        313 TQRQLSSLAQLPPGWNIDYGRQLVEQAQILWPE--QARPLVQAWQQQQKANALSAGSLSGWHQGMTKLTQLSERLSRLDE 390 Erwinia ...
RQM65583             53 YQNQLTRLEQTSPLYWYRYGEGLRNSLLMLYPDslAVKALDKQWQAQLGGQQGDVISVPTYLDARAGVDALLDQLLELER 132 Aeromona...
jgi:Rahaq2_4598     383 QRGKyMTVSQLKSSVFAIQQALNGSPPVEESLRKLAQdKQQNKDVSPQLMMQLDNQFTQLLNRYVLLT 450 Rahnella aquatilis C...
WP_015958620        381 QKGKyLTVSELKTAVFAITQSFNRAVPLEEQLRQLAA-LPVDQPWPAARGSLAELHLQQLIVEYALLK 447 Klebsiella pneumoniae
Q7MZS6              389 KRGRyLTGSELKSMVFGIRQPLANTPPLEELLRQLAEqKKSG-TVSLALLMQINTRFNQLLNRYYLLl 455 Photorhabdus laumond...
Q6D1L5              406 QRRT-VTISYLKSKLYDMQKDLISDVPFGIRLRELEArKIKSQSLTPAELRGMEDELRAFNIRLYRLQ 472 Pectobacterium atros...
WP_024911326        371 VRGS-LTISYLKTAVYQMQTELNREIPLEELLRQLSVaRESHQPVSPVLLKQIDERWNALLSRYHQLT 437 Chania multitudinise...
Q74PG2              104 SRGS-LTISYLKTAVYQMQTELNREIPLEELLRQLAVsADEHQPASPVLIKQIDDRWNALLSRYHHLT 170 Yersinia pestis
CAR41711            364 NRGS-FTLSYLKTAIYDIQKQHNKVEPIEEKLRQLAVqIETGQPISPATLNNIDNKINGLLARYYDLQ 430 Proteus mirabilis HI...
WP_012986890        369 TRGS-FTLSYLKTAVYDLQRSHGSEVPLEELLRQLNGrVVNGEPVPPVLLKGIDDRFNALLGRYDRLR 435 Xenorhabdus bovienii
CBJ92560            371 TRGS-FTLSYLKTAIYDIQRSHGSDVPLEEQLRQLSVyAAKGDSAPPVLLKGIDDRFNALLGRYDRLR 437 Xenorhabdus nematoph...
goetting:EBL_c12050 392 QKGKyITVSELKSSVFSMMTAFGQSIPLEEQLRQMNQ-LPIDSPQRQRLSRDIEQHLRSQI--YTLGQ 456 Shimwellia blattae D...
WP_013200461        391 QKGKyMTVSELKSAVFATQQSFNQSIPAEEQLRALSQ-TPTGQPLPAAAKAQLEMHLKQLTASYAEIK 457 Erwinia billingiae
RQM65583            133 QRKT-VTISYLKSQLYEVQKNLMQNIPFSLRLGELEArKASQEPITAAELKSLENDLKALNIRLYQLQ 199 Aeromonas hydrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap