Conserved Protein Domain Family
DUF3700

?
pfam12481: DUF3700 
Aluminium induced protein
This domain family is found in eukaryotes, and is approximately 120 amino acids in length. There are two conserved sequence motifs: YGL and LRDR. This family is related to GATase enzyme domains.
Statistics
?
PSSM-Id: 403619
View PSSM: pfam12481
Aligned: 13 rows
Threshold Bit Score: 377.477
Threshold Setting Gi: 122208094
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002284777   2 LAIFHKAFAHPPEELNSPASR-DGSRKPKLPeeTLREFLSAHPaNTFSMSFGT--AAALAYVSPDRSy--PTHQRLFGGF 76  wine grape
Q9LIL3         2 LAIFDKNVAKTPEALQGQEGG-SVCALKDRF--LPNHFSSVYP-GAVTINLGS--SGFIACSLEKQN---PLLPRLFAVV 72  thale cress
Q9FG81         2 LAVFEKTVANSPEALQSPHSSeSAFALKDGS--LATHFASVNP-NSVTLNFGS--SGFVAYSLDNPD---PRVPRLFAVV 73  thale cress
KRG91376       2 LAVFDKSVAKSPEGLQSPHSD-SVSALKDGF--IAEHFSSVHP-GSVTVNLGS--SGLLAYSLHRQN---PLLPRLFAVV 72  soybean
XP_015630487   2 LAVFDRAVAPSPEGLRHPGAAgD------GAagLAERFRDARP-GAVTVALGPggANSLAYSSHGQS---PLLPRLFAAT 71  Japanese rice
Q2RAK8         2 LAVFSGAVVEVPAELVAAGSRtPSP--KTRAseLVGRFLAAAEp-AVSLQLGD--LGHLAYSHANQS---LLRPRSFASK 73  Japanese rice
NP_001288918   2 LGIFSGAIVSLPEELVAAGNRtPSP--KTTGsvLVNKFVEKNP-SAVSVQVGD--YVQLAYSHHKES---PLRPRSFGAK 73  field mustard
Q3HVL7         2 LAVFEQSIGKPPSELSTQK------KEAKTEeeIAESFKSWKP-DSTFYHLSN--GNFMAFSHENEN---PLHPRSIVVM 69  potato
XP_015635960   2 LAIFQKQVAHAPAELNSPRSS---AAKPKNPdeILRDFHALHPiEAFSTSFGG--GAALACVAGHARnglSGYERMFCGL 76  Japanese rice
Q9LE80         2 LAIFQKAFAHPPEELNSPA-ShFSGKTPKLPgeTLSDFLSHHQnNAFSMNFGD--SAVLAYARQET----SLRQRLFCGL 74  thale cress
KRH10823       2 LGIFKQKLVNAPKELNSPA-SlNSCIKPKLSheILKDFMSCNSsNAFSMCFGN--DALLAYSTSYKP---SINHRLFSGL 75  soybean
XP_002283483   2 LAVFHKSIAEAPEGLRTPDSA-SLPALKDGF--LPQFFASLHP-SAVTVNLGS--SGAISYSVDKQN---PLLPRLFAVV 72  wine grape
XP_002315748   2 LAVFDKTVAKCPDALQSPHSApAASVLKDGF--LANHLASLHP-GSVTVNLGT--SGLIAYSLDKQN---PLLPRLFAVV 73  black cottonwood
XP_002284777  77 DDIYCLFMGSLNNLCTLNRQYGL-SKGSNEAMLVIEAYRTLRDRGPYPADQVVKDLEGSFAFVVYDSKAGTVFTALGSDG 155 wine grape
Q9LIL3        73 DDMFCIFQGHIENVPILKQQYGL-TKTATEVTIVIEAYRTLRDRGPYSAEQVVRDFQGKFGFMLYDCSTQNVFLAGDVDG 151 thale cress
Q9FG81        74 DDIFCLFQGHIENLPFLKQQYGL-NKITNEAIIVIEAYRTLRDRGPYPVDKVVRDFHGKFAFILFDSVKKTVFAAADADG 152 thale cress
KRG91376      73 DDIFCLFQGHLENVANLKQQYGL-NKTATEVIIIIEAYRTLRDRGPYPAAQVVRDFQGKFAFILYDSGSKTAFVAADADG 151 soybean
XP_015630487  72 DEIFCLFQGTIENIAVLKQQYGLhNKGSTEINIIIEAYRTLRDRGPYPADQVVRDINGKFAFVLYDCSNNSVFMATDADG 151 Japanese rice
Q2RAK8        74 DDIFCLFEGVLDNLGRLSQQYGL-SKGANEVLLVIEAYKTLRDRAPYPASFMLSQLTGSYAFVLFDKSTSSLLVASDPEG 152 Japanese rice
NP_001288918  74 DEIFCLFQGSLDNLGSLKQQYGL-AKNANEVLLVIEAYKTLRDRAPYPANHVVSHLSGDFAFVVFDKSTSTLFVASDQEG 152 field mustard
Q3HVL7        70 DDIFCIFSGGLDNTFDLRKHYGL-SRQATEAMIMVEAYKVLRDRAPYPPDQVIKELEGKFAFILFDSKASTLFLARDRDG 148 potato
XP_015635960  77 DDIYCVFMGRLDNLSSLIRQYGLcSRSTNEALLVIEAYRTLRDRGPYPADQVVKDLSGSFAFVVFDNKSGAVFAALSTDG 156 Japanese rice
Q9LE80        75 DGIYCMFLGRLNNLCTLNRQYGLsGKNSNEAMFVIEAYRTLRDRGPYPADQVLRGLEGSFAFVVYDTQTSSVFSALSSDG 154 thale cress
KRH10823      76 DNIYCVFLGGLHNLSMLNKQYGL-SKGTNEAMFIIEAYRTLRDRGPYPADQVLKELEGSFAFVIYDNKDGTVFVASGSNG 154 soybean
XP_002283483  73 DDIFCLFQGHIENVALLKQQYGL-NKTANEVIIVIEAYRTLRDRGPYPADQVVRDLHGKFAFVLYDSSNRTAFLAADADE 151 wine grape
XP_002315748  74 DDIFCLFQGHIENVAVLKQQYGL-NKTANEVIIVIEAYRTLRDRGPYPADQVVKGILGKFAFILYDSTSKATFVAVDADG 152 black cottonwood
XP_002284777 156 GVKLFWGVAADGSVVISDDLGVIKAGCAKSFAPFPTGCMFHSD-GGLMSFEHPMNKMKAMPRIDSEGVMCGANFKV 230 wine grape
Q9LIL3       152 SVPLYWGTDAEGHLVVSDDVETVKKGCGKSFAPFPKGCFFTSS-GGLRSYEHPSNELKPVPRVDSSGEVCGVTFKV 226 thale cress
Q9FG81       153 SVPFFWGTDAEGHLVFSDNTEMVKKGCAKSYGPFPKGCFFTSS-GGLRSFEHPKNELKPVPRVDSSGDVCGATFKV 227 thale cress
KRG91376     152 SVPFVWGTDADGNLIFSDETEIVTKSCGKSSAPFPKGFFFSTS-GGLSSFEHPLNEVKPVPRVDSSGQVCGATFKV 226 soybean
XP_015630487 152 SVPFYWGVDPDSRLVVSDDDEIVNKACGKSSAPFPKGFFFTTS-GGLQSYEHPMNEVKPVPRLDSKGEVCGTTYTV 226 Japanese rice
Q2RAK8       153 KVPLFWGITADGSVAFSNDIDLLKGSCGKSLAPFPQGCFYSNAlGGLKCYENPKNKVTAVPANEEE--ICGATFKV 226 Japanese rice
NP_001288918 153 KVPLYWGITADGYVAFADDIELLKGACGKSLASFPQGCFYSTAlGGLRSFENPKNKITAIPAREEE--IWGATFKV 226 field mustard
Q3HVL7       149 SVPLHWGIATDGSLVCSDDSEFIQASCGKLYTPFPPGCIFISD-TGLISFDHPMHKVKGIAREDDEGNVNAVIFQV 223 potato
XP_015635960 157 EVPLYWGIAADGSVVICDEREIVKGGCGKSYAPFPVGCMFHSE-GGLKSFEHPMNRLKAMPRVDSEGVMCGATFKV 231 Japanese rice
Q9LE80       155 GESLYWGISGDGSVVMSDDIQIIKQGCAKSFAPFPNGCMFHSE-TGLKSFDHPTNMMKAMPRIDSEGVLCGASFKV 229 thale cress
KRH10823     155 HIELYWGIAGDGSVIISENLELIKASCAKSFAPFPAGCMFHSE-HGLMNFEHPTQKMKAMPRIDSEGVMCGANFNV 229 soybean
XP_002283483 152 SVPFFWGVDSEGHLVLSDDEETVKKGCGISFAPFPKGCFFTTS-GGLRSFEHPLNELRAEPRVDSSGQVCGANFKV 226 wine grape
XP_002315748 153 SVPFFWGTDSEGNLVLSDDVQIVQKGCGKSFAPFPKGCFFTTS-RGLRSFEHPMNELKPVPRVDSSGQVCGSTFKV 227 black cottonwood
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap