Conserved Protein Domain Family
PKK

?
pfam12474: PKK 
Polo kinase kinase
This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with pfam00069. Polo-like kinase 1 (Plx1) is essential during mitosis for the activation of Cdc25C, for spindle assembly, and for cyclin B degradation. This family is Polo kinase kinase (PKK) which phosphorylates Polo kinase and Polo-like kinase to activate them. PKK is a serine/threonine kinase.
Statistics
?
PSSM-Id: 403615
View PSSM: pfam12474
Aligned: 61 rows
Threshold Bit Score: 79.9261
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003383893  519 ITSERETQDKKLEAEQQELKQRYQSELDSLQKKSMKELEKLEQQQIQEYKARTKQLKADQSKELKRYRENQKKDEKE-EK 597  Amphimedon qu...
XP_005155384 1086 yHLFKQQVKEQYSLQRQQLTKRHNKDKERASRFQQSLLEEQKSLQAQERASFLKTQKAEAKSRLNQLKMELRKQG---LS 1162 zebrafish
XP_009031429  381 nKLVKMQLKDSFFLKRNQMMDRQEKEMELCHRANNRQKEELNCSQLIEKKRLPKIQKADCKTRIAMYRQSLKIGSMPpLN 460  Helobdella ro...
XP_001640804  740 HQLAKTQLKETFFLQRSQMLNRHLKEVEQHQHLTKLQEEDMKRRHEIERKRLPKIQRNEIKSKTQNYRKSLRVDKQ--MS 817  starlet sea a...
XP_022536437 1205 yHLFKQQVKEQYSLQRQQLSKRHNKDMERASRFQQSLVEEQKSAQAQERGRLLKAQRAESKTRLTQYRQELRKQG---LT 1281 Mexican tetra
XP_015197419 1110 yHLFKQQVKEQFSLQRQQLIKRHSKDKERAMRFHQSLLEEQRSLFAQERARLPRTQRPEAKNRLAQFKLRLKSQG---LN 1186 spotted gar
XP_017948158 1114 YQLFRQHITEQHSLQRQQLRKRHEKDMERLKHYQSLLVDDMKSKHTQERSQWQKAQRTEARARQAMFKERVKSQG---LS 1190 tropical claw...
XP_005996976 1402 yHLFKQQVKEQFSLQRQQLLKRHEKETERMNRFHQFLLEDLKGKQAQEKGRLPKFQRNDAKTRLAMFKESLKIQA---IS 1478 coelacanth
XP_015792140 1140 HQLAKRQLEDIIKLQRIQIFTRHEKELEQLKRMSQRQEDQLLKRQAVERRQLPKHIRAEMKARELMFRESLRCSSAN-LH 1218 two-spotted s...
XP_003383893  688 HQLQKQQVREAFHMQRHQMQMRHQKEYDQQLRRDNFRLDELKQTQLFEKKQLPKQLNAEFKVQLNELRKTMGL-----RR 762  Amphimedon qu...
XP_003383893  598 KKIe--KETPKKELKKRTAEWKESFDARKVEQ-DVHFQSQLDGQFDREMGQLLGDQRSRMKEAE 658  Amphimedon queenslandica
XP_005155384 1163 GPEq-rQHLTQLLSEEEARQKQEKQSLQESHEsQLKAVQEQCDASTAELQQLQNEKLQVLVDME 1225 zebrafish
XP_009031429  461 ADEe-kEKIKMFEEKEKERMKADTQRMLERQKkQKAQLQERINASVKELELIQNEKRRMLIDFE 523  Helobdella robusta
XP_001640804  818 LEDe-kELMRTFEEAERKRAKSEYEKMLIRQDlEVEELRTTTESALKELQQLQNEKRHMLMESE 880  starlet sea anemone
XP_022536437 1282 GPEq-rHKITQFLAEEESRQKQERSQLQETQEsQLKEVQEQCDANITELQQLQNEKLQVLVEME 1344 Mexican tetra
XP_015197419 1187 SQEm-rQRLTQFLAEEESRQKEERLSLQQSQErQLRELQEQCDSNIAELQHIQNEKLHVLVEWE 1249 spotted gar
XP_017948158 1191 ASEq-kERSKQFLLQETAYQKSETQRQQQRQEeEMKKLQQHLEETCNELQQIQEEKIQTL-QAQ 1252 tropical clawed frog
XP_005996976 1479 APEq-rEQIKQFHQQEEARQKAEIQQQQQKHEaQLTELQEQLNSNISELQQLQNEKLHLLVDRE 1541 coelacanth
XP_015792140 1219 NVEderERIRKWQESEKLRYKAQQQEQENKHRkQLEDLRAASEAAIRELEHSQNEKRKSLLNYE 1282 two-spotted spider mite
XP_003383893  763 TAEd-kAKLKKLEQRYIIKEESERSLMKEKHTrDLETQKAEMENNIREMVEIQNEKKLTLTQQE 825  Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap