Conserved Protein Domain Family
DUF3689

?
pfam12463: DUF3689 
Protein of unknown function (DUF3689)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 399 and 797 amino acids in length.
Statistics
?
PSSM-Id: 403607
View PSSM: pfam12463
Aligned: 8 rows
Threshold Bit Score: 382.922
Threshold Setting Gi: 470326543
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFX70496      385 VQEILAKLGIGPLLSALFEQFLWK--PSTTRHTTDHA-----NQCNCSPEMILKIQLLRLVHNFCSH----STYKHVLLS 453  common water ...
EKC31288      378 VQRKLAELKLAPGLSELFDQFIWK--CQVSRYSSRHRlrghnAACECSPEVALKIQFLRLVHSFCDH----SDYKHLLLS 451  Pacific oyster
XP_781318     428 VHEILAQYKLMPGLNNLFDKVIWR--C-----NLRAPihgvnENCDCSPEVALKVQFLRLLHTYCDH----HDNKYLIMT 496  purple sea ur...
XP_001381444  449 VHKMIAEFKLIPGLNNLFDKLIWR--KHS---TSTLVlhghnQNCDCSPDITLKIQFLRLLQSFSDH----HENKYLLLN 519  gray short-ta...
XP_004364721  726 tQTRLAQLGLVPILCKAYSFMHWR--P-----IPPTPahssnLNVD---NTTVKVQYLRLLHGMADGip-dSRHHRLFFA 794  Capsaspora ow...
XP_026695649  366 VQKRLMKCDFVNRLNNSFEEVIWKdfPDIPDLSADSE--------DISQTTFVRVQFLRLVHSIADS----TSYRYSLLS 433  vase tunicate
KAE8909144    528 fQERLAEMGLVKTLNTMFDKFQWT--ATAPPAPAHEPlh--gPGCDCSLDASLKIQFLRLIHNFCDRdysdNSSKLLLLS 603  Phytophthora ...
KAE8576734    292 VHKMIAEFKLIPGLNNLFDKLIWR--KPS---ASTLVlhghnQNCDCSPDISLKIQFLRLLQSFSDH----HENKYLLLN 362  tropical claw...
EFX70496      454 YGEMDELKQLygefessmvpsstssTSSSSSAST-SSGIGVASSMAslpyC-TGGSGLLSKIIRVL-KNVPTSSIFRFWL 530  common water ...
EKC31288      452 KNELNEVVRI---------------NTKAGSLAL-SNLSSVNKQLM----C-KGSKGLLTKIVEVM-KKEPTTSTFRFWL 509  Pacific oyster
XP_781318     497 RHEINDLNRI---------------SSSSNIPQL-EAVKKIDRTLL----C-QGQKGILTKLVDVM-KKEPRDSPFRFWM 554  purple sea ur...
XP_001381444  520 SQELNELSAI---------------SLKANIPEV-DAVVNTDRSLV----C-DGKRGLLTRLLQVM-KKEPTESSFRFWQ 577  gray short-ta...
XP_004364721  795 QAELSQIRTI---------------------ERL-WRVQRGPEQFAkatfC-REPVGLVKLMMHELcSNETLDASMKFQF 851  Capsaspora ow...
XP_026695649  434 IEELHTLKQI---------------AEKKNHSLP-SEFPTLTNDTA----ApLSKRSLLSQVMSKL-HQESIT----FWI 488  vase tunicate
KAE8909144    604 EHEVQLMNDG---------------GSTPINLD-------------------HPDKGLLSKIVHAL-IEQPVDSIYRFWL 648  Phytophthora ...
KAE8576734    363 SQELNELSAI---------------SLKANIPEVeAVANTD-RSLV----C-DGKKGLLTRLLQVM-KKEPAESSFRFWQ 420  tropical claw...
EFX70496      531 CRAVESWLRSSSQYgvADQLFVINRGLLQHIVHVLLESE-CPPREVAQSSFDLLGEMIRFNMEACRQLDILLPNEAKVSK 609  common water ...
EKC31288      510 ARAVESYLRGNTSY--CDQVFLMRRGLLQHVASNIVEHE-IRHKEILQSSFDLLGELIKFNVEAFKTFEEILHTQPNFDK 586  Pacific oyster
XP_781318     555 ARAIESFLRGKTSY--ADQTFLIRKGLLEHVVQHILSSD-HHSKEVLQSYFDLLAELMKFNILAFKRFNKAINSEEQFMQ 631  purple sea ur...
XP_001381444  578 ARAVESFLRGATSY--ADQMFLLKRGLLEHILYCIVDSE-CKSRDVLQSYFDLLGELMKFNIDAFKRFNKYINTDEKFQV 654  gray short-ta...
XP_004364721  852 VVAIESHIRGATS---AERALLATSDFFQFLLDELLSPE-FKTSSILQSLFDLLGELIRFCPVLLMQFSD-LCTDEAFAR 926  Capsaspora ow...
XP_026695649  489 TRVVEAFLRGPTNP--TTQAFLLDKNIVESTVGVLISTR-PMHELVRQGCFDMLSTVMKVNVDAFTRCDNALNSARKFQT 565  vase tunicate
KAE8909144    649 ASCVEAFLRRAAP---SEQLFVARTPLLQALITEILSGGaYRSQGSFQSAFDLLGEMTKGNWETLQLFHGLLSNT-QFAA 724  Phytophthora ...
KAE8576734    421 ARAVESFLRGVTSY--ADQVFLLKRGLLEHILYCIVDSE-CKSRDVLQSYFDLLGELMKFNIDAFKRFNKYINTDEKFQI 497  tropical claw...
EFX70496      610 YLEVVHGNLIDSNMFLRSVFLTMDHCMEggsggrfQQ----AAVFFPTSKFFSWFLHLRRRVCYLALLVSSISvdtltlE 685  common water ...
EKC31288      587 FINTVNRNLVDSNMFIRSLVLSLEHLMN-------EEvv-fMDYAKKENKLLMYIGDFNRQLDYLYKLIKIIN------E 652  Pacific oyster
XP_781318     632 FIELVHTHIVDSNMFVRCLALTIEHFEK-------EQpe-nYEWGIQSCRLLQYISKRENRLTFLFKLINIIHveiltqE 703  purple sea ur...
XP_001381444  655 FLNQINSSLVDSNMLVRCITLSLDRFES-------QSdm-kVVHVLSECRLLSYMYQMNNRTTFLFRLINIIHvqtltqE 726  gray short-ta...
XP_004364721  927 LLHVISLHLVDANVFLRSIMMTISHYSQhhrttaeSDc---tSYIPERCKFAAFFGDPANVMWLCAQLMLVISidelsqE 1003 Capsaspora ow...
XP_026695649  566 FISAVEDSLIDSNMFIRCVILTTHYI---------QTsqteNKEVLVTNRLLEYYTNHKRRIQVIARLVTLLDvstlsqE 636  vase tunicate
KAE8909144    725 FMEVVILNLVDSNVFIRSMLLSSEKFAKqpqs-----gtfgLADDYEMDRMSEFLTVNLVRL--LRDLMTIVTmddinhE 797  Phytophthora ...
KAE8576734    498 FLNQINSSLVDSNMLVRCIALSLDRFES-------MSddikVAEVLSECRLLSYLTEGSIRMNFLFRLINIIHvqtltqE 570  tropical claw...
EFX70496      686 NVSCLNTALIILMLAARQGTLANCLKML 713  common water flea
EKC31288      653 NVSCLNTTLVFLMFANRKNALPRYLQAL 680  Pacific oyster
XP_781318     704 NVSCLNTTVIFLMFADRIGELSRYLTDL 731  purple sea urchin
XP_001381444  727 NVSCLNTSLVILMLARRKDKLPGYLNAL 754  gray short-tailed opossum
XP_004364721 1004 NICCLNSALVIFVFAYREGQLASFVerl 1031 Capsaspora owczarzaki ATCC 30864
XP_026695649  637 TVSCLNTSLLLLIMAHRNNRLASYLQCl 664  vase tunicate
KAE8909144    798 NICCLNTAIVILVFQHRRQRLPAILEAL 825  Phytophthora fragariae
KAE8576734    571 NVSCLNTSLVILMLARKKGRLPCYLQNI 598  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap