Conserved Protein Domain Family
Helicase_IV_N

?
pfam12462: Helicase_IV_N 
DNA helicase IV / RNA helicase N terminal
This domain family is found in bacteria, and is approximately 170 amino acids in length. This family is found in bacterial DNA helicase IV, at the N-terminus of pfam00580.
Statistics
?
PSSM-Id: 403606
View PSSM: pfam12462
Aligned: 26 rows
Threshold Bit Score: 136.633
Threshold Setting Gi: 500122388
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCO61012              1 MQVTASRSAKFLIQSEYNEVCIEGD--KLILNSAQSEEHIPFSVWDgSITLKRGLMWGSLVFHAHAknnkQQAWLVQGLP 78  Vibrio n...
Q7MEP1                1 MLLTANKTAQFFIQKEYHHVELQGQ--SLLLVSVGSEEHIPFTVWNgEIHVKRGLFWGALQFFAHPvegkQQSWLVQGLP 78  Vibrio v...
Q87ID4                1 MQLTATSKAQFFIQNEYYHVEIKEN--SVLLSSIGSEEHIPFTVWNgKVNVKRGLFWSSLQFFAHEqdgkQQSWLVQGLP 78  Vibrio p...
CAV25975              1 MQLSANKTAQFFIQNEYHQVELDGP--RLLLSSVGSEERIPFTIWSgKIAIKRGLFWGSLQFFANQqdgkQRSWLVQGLP 78  Vibrio t...
Q9KLM6               13 MQLNANKTAQFFIANEYYQVQLEKE--WLVLTSLSSEERIPFHVWNgEVQIRRGVFWGTLQFFAHPeegvQRSWLVQGLP 90  Vibrio c...
JLExeter:vfu_B00338   1 MQLSAKKTAQFFISNEYHQVGLEDE--WVVLSSHLSEERIPFNVWNgQIKIHRGLVWGALQFYAHEeqgvQRSWLVQGLP 78  Vibrio f...
Q6LST7                1 MRLSASVLAQWFVQGDYFSIELNEH--SLTLDSQTETSTISFDDWDgAIEVHRGVVWGSLELTSADq---QYCWTIHGLP 75  Photobac...
Q5E4C9                1 MQIKATPFAQWLVQGDFYQLELEQE--QLLFTSHKYQVSVPFDKWSgKVTFERGLIWGALCFYNRNe---QVAWRVSGLP 75  Aliivibr...
WP_011798393          3 qSWGPSGPGKLFTNSPAWNLTLDGEqfALEVRGKAQTGSVLLLE---SLAIEPGTFWTALHFPSKN----GKRQSLDGIP 75  Polaromo...
ADD76565              1 MELKATSMGKRLAQHPYNRVRLLTA--GVEVSGDKHEYLIPFNQLS-DITCKRGMVWGELEFLLAD----NKVVRLHGTE 73  Pantoea ...
CCO61012             79 WEDCNRFVKQAQHEYSS-----------------------WHYNQCKSLNEKLPSWQETLDLMRSQP---------AYLP 126 Vibrio n...
Q7MEP1               79 WPECKQFARNAVEQYQQ-----------------------WHDQQCRQLSQYLPIWEDGLHRLIYLP---------AYLP 126 Vibrio v...
Q87ID4               79 WPQCRKFALEAVRQYQD-----------------------WHNTQCRKLAEYLPKWEEELYQLKHLP---------AYLS 126 Vibrio p...
CAV25975             79 WEQCRQFARASVAAYQK-----------------------WHDRQCEQLAEHVPQWEDELTRLEQLP---------AFLP 126 Vibrio t...
Q9KLM6               91 WPECRHFAHQLVAHYQA-----------------------WHNRQCEQLSLYFPRWQQELSRLKRLP---------SFLS 138 Vibrio c...
JLExeter:vfu_B00338  79 WPECRQFAHKLVAIYQG-----------------------WHNRQCAQLSHYLPKWQNELSYLQRLP---------SFLP 126 Vibrio f...
Q6LST7               76 WQQCKPFAARLLESYRD-----------------------WAHGRVDRLDKALPDVLNRINSFATQQ---------GYLR 123 Photobac...
Q5E4C9               76 WEECDAIINAVLNAYAD-----------------------WKESKVLLLNQLQPQMIELIENFSANK---------RFLK 123 Aliivibr...
WP_011798393         76 NEEAASLRQTLFSTIEQirhrervqallkdfntvtapvltWAKQAVQAAKDQLQKKGWLTHEFVQRQnegkptglsKYLS 155 Polaromo...
ADD76565             74 WQETQRFYHYLMQAWQD-----------------------WSHEMSDVCASVLQGLRAEINGFSEQD---------RWLK 121 Pantoea ...
CCO61012            127 TSQLNNWKNAVSEDFASLNMSLEEAQQRMP--DAMTSVSDWL 166 Vibrio nigripulchritudo
Q7MEP1              127 HSTVDTWVRDVHGQLKEMNMTLDEAKQRLP--ERVAAMESWL 166 Vibrio vulnificus YJ016
Q87ID4              127 HSQVMAWVEKLNQELAEIKTSLDEAKMRMP--NRMGEIEPWL 166 Vibrio parahaemolyticus
CAV25975            127 HSKVNTWVDMVNAGLENMTMTLEEAAQRMP--NRIARMQPWL 166 Vibrio tasmaniensis LGP32
Q9KLM6              139 HSSVEAWVAQVYADLKLMDMTLHEAQKHLP--TVFDTLLPWL 178 Vibrio cholerae
JLExeter:vfu_B00338 127 HSLVDHWVTSVFDDLSSMGMTLEEAHQRLP--EHIEHLSPWL 166 Vibrio furnissii NCTC 11218
Q6LST7              124 ESEHDNLCKFLDDSLKTTGLTPELAASFRP--MAFERIEPWL 163 Photobacterium profundum
Q5E4C9              124 QTEALMMVEKLYDLFEQTKISIPLAEQLQP--DCIAPVIDWL 163 Aliivibrio fischeri ES114
WP_011798393        156 TPEVANHVEKQSAQFHA-------------------DLKFWK 178 Polaromonas naphthalenivorans
ADD76565            122 RSELQAINDQILKQFDALPLPLSRINDFEScrENWAFCQHWL 163 Pantoea ananatis LMG 20103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap