Conserved Protein Domain Family
DUF3685

?
pfam12452: DUF3685 
Protein of unknown function (DUF3685)
This domain family is found in bacteria and eukaryotes, and is approximately 190 amino acids in length. There are two completely conserved residues (L and D) that may be functionally important.
Statistics
?
PSSM-Id: 403598
View PSSM: pfam12452
Aligned: 45 rows
Threshold Bit Score: 236.232
Threshold Setting Gi: 147850417
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009555272     408 LSKIPMVTDFLAHLLFQVPLMVDETTYAVGTVEAMTRMEALLQNLIIQVGNAVIQPLLNRFGNVVAVKQNFYDRRLLSTR 487 Oscillatori...
Q31M87           336 varlhGDRQVLLTLVHGLPVMIDGTAYALEAPEAQARLQLLLENLLLRLANAIVQPLLNCFAEVTAIKQEFYDAQHLSNR 415 Synechococc...
jgi:Cyagr_0755   357 dlELPDPAVMLSPLLQARPLLVDGRLVAPDEPQAVLYLELLLSNWLVRSAELISAEVLAACADWPELRRYLLRPELLATR 436 Cyanobium g...
Q7VC71           346 DEELPFPSLMLDSLILNKPLLLEGNLLPPDDPRALIKLEMLIMNWLIRTAEIISSELISACSEWPELREYLLKPSLISTR 425 Prochloroco...
CAK23587         341 DEELPDPMTMLAALVQDQPVLVDGQLLPADDPRALLQLETLISNWLVRTAELIGGELLGVCGEWPELRRYLLDQALISTR 420 Synechococc...
Q7V851           361 DQELPDPQRMLAPLLLDRPVLVEGQLLPADSPRALLQLEMLVGNWLVRTAEIISAEVLGTCGEWPELRRFLLNQHLISTR 440 Prochloroco...
CAK27911         338 ADLLPS----LLALIEGRPLLIDGGLQAPDEPAALLHLQRLVSNWLIRNGELISRELLNNCSGWPELRRAVLLPDLLATR 413 Synechococc...
jgi:PCC7418_2971 367 LNKLPDVTALVAYLLYQEPLKIDQVSYRPESPEAQARAEMLLHNLIITVANAVMQVILNQFGEQEMVKNSLYADEYRSSR 446 Halothece s...
Q8DGJ4           348 LKRIPFVAEMLAHLLVQQPLTLHQQTYRYGTAAALEILDALLDHWLLTVANGIVYPLLNRCCYSAVIQQTFFQPQYISTR 427 Synechococc...
jgi:Syn6312_0465 359 LQKIPLVDQLMAHLLWQQPLMIENSLQAWGTPTALAHLSQILDNLILQMANAVIHPLLNRFAHEDAIKGLFYDRRVLSFR 438 Synechococc...
WP_009555272     488 EIERFRNNLSWKYRINRYFKEPTAIFESRYNLFVFGELGIVKTSVYSPRNQELDELSGVGLAVTLALEARDAIAPRLRSA 567 Oscillatori...
Q31M87           416 ELTRFRNQLNWADRWEQLLENPRSIYESQWPLLHFVADGIDRCQVYAPRDQELQQLSGVQQTITLVMEARDAIAPQVSGL 495 Synechococc...
jgi:Cyagr_0755   437 NLERLRNQLNAQQRWTSWFERPIHLYESRRPLFRLGDGAIDCVDLTEPRDAELRQLGWVQQAVTLALEARDALGPQLRSL 516 Cyanobium g...
Q7VC71           426 ELEKLRNQLNYQRRWQYLIDHPIQLYESKRQLFKFNEGNIESVLINEPRDNDLRRLGWWQKQVTLLIETRDALAPQLQSL 505 Prochloroco...
CAK23587         421 ELERLRNQLNSQSRWQEWIERPIRLYESRRLLYRLHAGQIEPLLLTETRDEELKTLQWWQQQVALLVEARDAIAPQVQSL 500 Synechococc...
Q7V851           441 ELERLRNQLNSQARWQNWIQRPIQLYESKRLLYRLRDGIIEPLLLTEPRDEELSQLGWWQQQVALLLEARDALAPSMQSL 520 Prochloroco...
CAK27911         414 QLDQLRNRINSAERWHTLVERPLAIYESRRLLFDIQAGRVEPTMVCDLRDAELRQLSWWQQAFTLLLEARDALAPQVELL 493 Synechococc...
jgi:PCC7418_2971 447 EIARFRNELSWQYRQSYYFQEPKIIFESRQEFLVFRGNRIQAVSVYAPRKEELEQLQGIRLGVTIALELRDAIAPRFRAV 526 Halothece s...
Q8DGJ4           428 EIERFRNALSWHYRWQCWVKEPQNIFESRLVLLRLTERGIQELALTVPRQRELMQLEGIPYALTLALEARDALAPPVRAV 507 Synechococc...
jgi:Syn6312_0465 439 DMERFRNALSWKYRWQTLVIEPQEIFESRVSLLVLSATGISKTSLYLPRIPELEQLEGLRYGVTLALEARDAVSPPLRAA 518 Synechococc...
WP_009555272     568 ISFVGSGVVYILTEVIGRGIGLIGRGIIKGVG 599 Oscillatoriales cyanobacterium JSC-12
Q31M87           496 IRWLGSGVVFVLTQLLGRGIGLVGRGVLQGIG 527 Synechococcus elongatus PCC 7942
jgi:Cyagr_0755   517 LKRLGDLLVVLLTQVLGRAIGLVGRGIVQGMG 548 Cyanobium gracile PCC 6307
Q7VC71           506 LKYIGDLMVVLLTNVLGRAIGLVGRGIAQGMG 537 Prochlorococcus marinus
CAK23587         501 VKRFGDLMVVILTQVVGRAIGLIGRGIAQGMG 532 Synechococcus sp. WH 7803
Q7V851           521 IKRIGDLMVVVLTQVLGRAIGLVGRGIAQGMG 552 Prochlorococcus marinus str. MIT 9313
CAK27911         494 INRVGGLMVLLLTRVVGRAIGLVGRGVMQGLG 525 Synechococcus sp. RCC307
jgi:PCC7418_2971 527 FGVVGQAVVYLLTQVIGRGIGLIGRGILQGIG 558 Halothece sp. PCC 7418
Q8DGJ4           508 VAWVGKGVVYLLTQVIGRGLGLIGRGILQGIG 539 Synechococcus elongatus
jgi:Syn6312_0465 519 IALIGQGVVYVLTQVIGRGIGLIGRGILQGLG 550 Synechococcus sp. PCC 6312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap