Conserved Protein Domain Family
AKNA

?
pfam12443: AKNA 
AT-hook-containing transcription factor
This domain family is found in eukaryotes, and is approximately 110 amino acids in length. This family contains a transcription factor which regulates the expression of the costimulatory molecules on lymphocytes.
Statistics
?
PSSM-Id: 403591
View PSSM: pfam12443
Aligned: 21 rows
Threshold Bit Score: 38.5649
Threshold Setting Gi: 1331810145
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008271618  592 FQRLQAAHRA-LEEEYLKASRAQHLARQLAGSEGTPGKFDPGRELEMKIYHLGTRLEELKDLVNQTQQAPEPSGCDSapd 670  rabbit
XP_023400780  523 FQWLKAAHTA-LEEEYLRACKDQHLTQQPASSEGMPGKFDPERELEAEIFQLGIRLEELKDHVDQHQQKPEPVGSDS--- 598  African savan...
PNI69567      219 CGQVGSPPEAdGPGSATSGAEKATTRRKAPST---PSP----------------------------KQRSKQAGSSP--- 264  chimpanzee
XP_023359198  322 ylQVNGEPLLdVSERAFSGLASETNVLKLSSS-TKEQLPSSPSQLLTK----AERCQELSEQTKNLKTKVEEFSKRI--- 393  Tasmanian devil
XP_011238451  322 SQQIQVQPAThTCQEPLTGLEPEKCCLNLTPT-PQKDPFSN-SYIFQKISHGKQMCQKLKEQTDQLKNKVQEFSKRI--- 396  house mouse
XP_012355927  327 SQQIQMEPTVhIHQELLTGIESEASLSKLSPT-SQKGTSSSSSYIFQKISQGKQMCQKLKEQTDQLKTKVQEFSKRI--- 402  northern whit...
XP_020945754  324 SQQTEMAPTRhIYQEHLTGIKSETSLSKSPST-SQKNP-SSSSCIFQKIAQGKQMCQKLKEQTDQLKTKVKEFSKSI--- 398  pig
XP_023612786  321 SQQTEMKPAThSHQEHLTGTGSETRLWKLSST-SQKDPSLSSS-IFQKISQGREMCQKLKEHTDQLKTKVQEFSRSL--- 395  little brown bat
XP_023366334  624 FQQLKDAHAA-LEEEYLKASREQYLAQQPTSSKGTPGEFDPSRELEAEIYHLGICLEELKDHMNQTQQESEPSRSDP--- 699  small-eared g...
XP_008262997  342 spgpKMKPPVpIRQELLPGVESETTLFKLTST-SQKDHLLNSSYIFLKISQGKQMCQSLKEQTEQLKSKVQEFSKSI--- 417  rabbit
XP_008271618  671 iAPDIapamPSSRQPRHLPTPPGQ 694  rabbit
XP_023400780  599 -AVDSppptPSPSHPTGLPSPSQQ 621  African savanna elephant
PNI69567      265 -RPP-----PGLWYLATAPPAPAP 282  chimpanzee
XP_023359198  394 -SQD-----FTPLEDNKQVLEELQ 411  Tasmanian devil
XP_011238451  397 -KQDS----FCHLQDIRLMNKEHA 415  house mouse
XP_012355927  403 -KQDS----PYHLQDKKLVLEKLQ 421  northern white-cheeked gibbon
XP_020945754  399 -AQDS----PYHLQDKRVVLEKLQ 417  pig
XP_023612786  396 -AQDS----PGYEQDERLELQKLQ 414  little brown bat
XP_023366334  700 -ALDSslatPLSHQPTHLPAPSEQ 722  small-eared galago
XP_008262997  418 -KQDS----DGHLQDGRLedrsgp 436  rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap