4R94


Conserved Protein Domain Family
PV_NSP1

?
pfam12433: PV_NSP1 
Click on image for an interactive view with Cn3D
Parvovirus non-structural protein 1
This family of proteins is found in viruses. Proteins in this family are typically between 109 and 668 amino acids in length. Parvoviral NSPs regulate host gene expression through histone acetylation.
Statistics
?
PSSM-Id: 403585
View PSSM: pfam12433
Aligned: 2 rows
Threshold Bit Score: 123.587
Threshold Setting Gi: 1353227
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4R94_A 185 LLTYKHKQTKKDYTKCVLFGNMIAYYFLTKKKISTSPPrdGGYFLSSDSGWKTNfLKEGERHLVSKLYTDD 255 Murine minute virus strain MVM...
P24030 192 PYKYFNKQTKQDYNKPVHLRDYTFIYLFNKDKINTDSM--DGYFAAGNGGIVDN-LTNKERKTLRKMYLDE 259 Aleutian mink disease parvovir...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap