Conserved Protein Domain Family
Peptidase_A2E

?
pfam12382: Peptidase_A2E 
Retrotransposon peptidase
This is a small family of fungal retroviral aspartyl peptidases.
Statistics
?
PSSM-Id: 152817
View PSSM: pfam12382
Aligned: 2 rows
Threshold Bit Score: 287.76
Threshold Setting Gi: 74583373
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q01910  216 KENDTKDRKPKKTNVSRIEYSSENFTKYKKRRYEMVLQAKLPEFKCSIPCLIDTGAQVNVITEETVRAHKLPTRPWLQSV 295  fission yeast
P0CT34  219 KNNTTNSRNLRKTNVSRIEYSSNKFLNHTRKRYEMVLQAELPDFKCSIPCLIDTGAQANIITEETVRAHKLPTRPWSKSV 298  Schizosaccharomyces...
Q01910  296 IYGGVYPTKINRKTTKLIINLNGISIKTEFLVVKKFSHPAAISFTTLYDNNIEISSS 352  fission yeast
P0CT34  299 IYGGVYPNKINRKTIKLNISLNGISIKTEFLVVKKFSHPAAISFTTLYDNNIEISSS 355  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap