Conserved Protein Domain Family
Peptidase_C3G

?
pfam12381: Peptidase_C3G 
Tungro spherical virus-type peptidase
This is the protease for self-cleavage of the positive single-stranded polyproteins of a number of plant viral genomes. The protease activity of the polyprotein is at the C-terminal end, adjacent to the putative RNA polymerase.
Statistics
?
PSSM-Id: 152816
View PSSM: pfam12381
Aligned: 3 rows
Threshold Bit Score: 437.382
Threshold Setting Gi: 123878960
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6EEL1 2617 DKGLAKDPNMVTILTDKLINISAVIVNLTPTRRAYMNVVRLIGTIVVCPAHYLEALEEGDELYFICFSLVIKLTFDPSRV 2696 Maize chlorotic dwa...
O11979 2603 YKSLDKDPNMVSILSNQLTKISCVILNVTPGRTAYLNVMRLCGTFVVCPAHYLEALEEDDTIYFISFSVCIKLRFQPDRV 2682 Maize chlorotic dwa...
Q1MNG4 2627 RAGVDRDLSMTNLIDTHMAGMSCIIISELGNVFRTFGVLRLCGTYVCMPAHYLDEITSEHTLYFVCPSKITQIQLERHRV 2706 Rice tungro spheric...
Q6EEL1 2697 TLVNSQQDLMVWDLGNMVPPSIDTLKMIPTLEDWDHFQDGPGAFAVTKYNSKFPTNYINTLTMIERIRANTQNPTGCYSM 2776 Maize chlorotic dwa...
O11979 2683 TLVNTHQDLVVWDLGNSVPPAIDVLSMIPTVADWDKFQDGPGAFGVTKYNARYPTNYINTLDMIERIRADTQNPTGIYKM 2762 Maize chlorotic dwa...
Q1MNG4 2707 CLVNGFQETVVWDLGPSVPPSRNYIDFIANADDWKNYKATSGALVMSKYSVDSMLQCVHFLDSIELTEANVSVPTSYYEA 2786 Rice tungro spheric...
Q6EEL1 2777 MGSQHTITTGLRYQMFSLDGFCGGLILRASTNMVRKVVGIHVAGSQNHAMGYAECLIAEDLRAAVARLALD 2847 Maize chlorotic dwarf virus
O11979 2763 LNSDHTITTGLRYQMYSLEGFCGGLILRACTRMVRKIVGLHVAASANHAMGYAECLVQEDLKHAINKLSPD 2833 Maize chlorotic dwarf virus
Q1MNG4 2787 NGGIHTIISGLRYRVHCMPGFCGAAIMRADATCFRKIIGMHVSGLRNKCMGYAETLTQEHLMQAIETLKKT 2857 Rice tungro spherical virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap