Conserved Protein Domain Family
TMEM131_like

?
pfam12371: TMEM131_like 
Transmembrane protein 131-like
TMEM131_like is a family of bacterial, plant and other metazoa transmembrane proteins. Many of the members are multi-pass transmembrane proteins.
Statistics
?
PSSM-Id: 372078
View PSSM: pfam12371
Aligned: 11 rows
Threshold Bit Score: 98.1456
Threshold Setting Gi: 74802289
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55EL4               513 FSISPASLEFRGSSLCVPVFRNVEFKNTHTKMKIQVLSLTNDIHPifFTNNFLGSVVLNPLQSINISIVFLPKELGVFKT 592  Dictyo...
WGS:AAPP:GF11553-PA   61 LRLMPPRLDFGTWSVGQARSQTVTLFNQHANRTLQINAVVGPNPA--FYSSFPGTREVAPKGNTTFTVVFLPRQLGAIAG 138  Drosop...
Q178A4                88 LVFQPSLLDFLERSIGDPHNQVVILINKHKSRSVFLGSISGSTPD--FYSSYFKESVIPPEGNTTFNVVFLPRQLGATDG 165  yellow...
Q7Q3Y5                 1 PPQLNFAERSIGDPHNQPVVLLNRHKNRSVYLGSISGSAAEFSSS--YFKEKMIPPGGNTTFSVVFLPRKLGPADGSLLV 78   Anophe...
XP_001744482          19 PVLVPPFLRFPQQELCKVAERVVTVVNGNPRADLHLYSISSNSND--FHSSWFEHAVVAPGDNTTFTIAFMSETLGPVEA 96   Monosi...
EEF39994             240 VEISPPVLDWGHKNLYFPSVAFLTVANMFNDSILYVYEPFSTNIQ--FYACNFSEFFLRPGEVASVCFVFLPRWLGLSSA 317  castor...
Q10QR8               230 VEISPPVLDWGKSSLYVASMATLTVVNLNNDSALRVYEPFSTDPQ--FYVYGYDDLVLQPRENASVTFIFLPKLLGSSSA 307  Japane...
jgi:MICPUN_57037     105 VSIVPTELKFVETPLCQPTTHVIHVYNMDQRETFKILSLTTDAVY--MQPVDFRSVEVPPGRGRQLKVAFLPRSLGGSHG 182  Microm...
XP_003056889          98 VSISPMDLDFGGPTLCSVASSHVTVMNKDPTKALKVTSVTTDHLA--FQPANFTPVELPPMGRARVKIAFIPRALGASHA 175  Microm...
Q18264                 1 MEMDPPMMDFGQNSVGTAQKRKIYIRN-MRNEQIFLDAVVVNSIE--FQASYFEQYKLEPHGVTSLEVVFLPREIGKRST 77   Caenor...
CAF93953               7 LHFQPPALDFGTQPLGLARAETIYIHNPSQEVPVTLLSMFTTSRH--FYIPFFHRRVIPPRGKASFKLIFLPSEEGNVEN 84   spotte...
Q55EL4               593 EFKIIT 598  Dictyostelium discoideum AX4
WGS:AAPP:GF11553-PA  139 DLHVHT 144  Drosophila ananassae
Q178A4               166 SIEIHT 171  yellow fever mosquito
Q7Q3Y5                79 HTSFGM 84   Anopheles gambiae str. PEST
XP_001744482          97 NITLLT 102  Monosiga brevicollis MX1
EEF39994             318 HLILQT 323  castor bean
Q10QR8               308 HLVLQT 313  Japanese rice
jgi:MICPUN_57037     183 SFRLLT 188  Micromonas commoda
XP_003056889         176 SFMVHT 181  Micromonas pusilla CCMP1545
Q18264                78 IVHFYT 83   Caenorhabditis elegans
CAF93953              85 TLFINT 90   spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap