Conserved Protein Domain Family
Fig1

?
pfam12351: Fig1 
Ca2+ regulator and membrane fusion protein Fig1
During the mating process of yeast cells, two Ca2+ influx pathways become activated. The resulting elevation of cytosolic free Ca2+ activates downstream signaling factors that promote long term survival of unmated cells. Fig1 is a regulator of the low affinity Ca2+ influx system (LACS), and is also required for efficient membrane fusion during yeast mating.
Statistics
?
PSSM-Id: 372065
View PSSM: pfam12351
Aligned: 27 rows
Threshold Bit Score: 68.9138
Threshold Setting Gi: 154703800
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001728035   65 LTSSS---N--GTLAPMQVRLGYFGMCGDDG-D--T--RTClsaagHYDPDEPQDIIHLtellfpqvmNNSNARGAIPEL 134  Neurospora cr...
XP_002843268   77 TIANI---V--GGAH-LEVRVGYFGICIQRNgG--G--FLC-----NQNATILAESLG-----------------VESDP 124  Microsporum c...
EEP81331       54 AIENI---V--GRAR-LEVRVGFFGICIQKDgG--S--FLC-----NANATALAGYTQ-----------------PEDDP 101  Uncinocarpus ...
Q0U808         77 AIANI---V--GNAQ-LGVRVGYFGICINRDgG--G--YIC-----SNNATALVDNLN-----------------VDQDP 124  Parastagonosp...
XP_002373515   76 ATANI---V--GGAE-MEVRVGYFGICVSPSgG--A--YIC-----NSNATALAEVVT-----------------VDQDP 123  Aspergillus f...
Q0CSC3        223 VVANI------SSTGNLAVRVGYFGLCMATNtGgdPvsWIC-----RGKAKKLVALVE-----------------GVQDP 274  Aspergillus t...
XP_010759250   62 LSAGI---N--RNATSLEIRTGYLGHCMKQNsg----lWIC-----ARNAEALANAIR-------------EQKASDADP 114  Paracoccidioi...
EEH10556       84 LTTGA---R--NNADSFEIRTGYLSHCLKQAsG--L--WVC-----ARDIQPLAKVIS-------------DQKKSNIDP 136  Histoplasma c...
XP_002563772   55 AVHNV---SqaGQGTTLEVRAGYMGMCVTQRhT--G--RIC-----SSNVQVLANLIQAqkp----vnNGNASTRFIPDP 118  Penicillium r...
XP_002385236   75 KVYNLsqpR--NTTI-QEVRAGYMGLCLTRSdG--A--QFC-----SSNAAALASMVKD---------QGLQGSNDTADP 133  Aspergillus f...
XP_001728035  135 QNMVLTGLDLQDQ-IFGKVLLTGSALFALGLVLMfplklv----kkklakLAPGTPLTKKqqfIRRACYSTIWAGLMIVF 209  Neurospora cr...
XP_002843268  125 LNLIWVASTFKDAvVFPYLIIVALIFAFLSFLLLatfpgwhe-elnqqgsDIEVKPFPSRp--VSQVALALIFVASVFIL 201  Microsporum c...
EEP81331      102 LNLIWVASTFKDAvVFPYLIIVALIFAFICFLILgtfpgwhe-elnddgsEREVLPFPSRp--VSQVALALIFISAVFVL 178  Uncinocarpus ...
Q0U808        125 LNLVWVAATFKDAvVFPYLLIVAIILAFFTFVLLatfpgwheerdeqtgsDVDVKPFPSRp--VSQVALALIFISSIFVL 202  Parastagonosp...
XP_002373515  124 LNLIWVASTFKDAvVFPYLLIVAVILAFFCFILLatfpgwhe-eidstgsEREVKPFPSRp--VSQAALALIFVASVFVL 200  Aspergillus f...
Q0CSC3        275 LNILAIADNFRDEvIVSVVIIIAIVMTLVGVYGMstfprwqdnmdddtgsEMEGTPVPSTa--ASSLIMAFESLSVLFLI 352  Aspergillus t...
XP_010759250  115 LNLLYMSKAFKDQtVFSGLIFASIPFVFICFLLLstfpgwhe-dlnssgsEQEVRPFPSRi--VSQLATVLAGLALLLIF 191  Paracoccidioi...
EEH10556      137 LNLIYMSKAFKDRmVFSGLIFASIPFLFVCFLLLatfptwqd-evdsngsEVQVKPFPSKv--VSRVTTVLVVLASLLAF 213  Histoplasma c...
XP_002563772  119 LNLIMMADEFKEKiVFNGLIYIVVALMFICFLLLstfpgwhe-evgddgdERQVKPFPSEa--ALLASLLAASASSGFGL 195  Penicillium r...
XP_002385236  134 LNLIWIAKNFKETiVFDGLIFIAVAVAFICFLALatfpgwhe-evdedgsEREVKPFPSRr--VSQAALGMSTLGFIFAL 210  Aspergillus f...
XP_001728035  210 AACIGTTETAGALGHATAHIKGSSILMKEGVTLQVLQWMAFGFMFLfvLTMPIMLF 265  Neurospora crassa OR74A
XP_002843268  202 VSVLWQHTASVAASTIAQDLGNGSVKSGVGTSAMLLGWFGFAFFII--VSIGLLCM 255  Microsporum canis CBS 113480
EEP81331      179 VSVLWQHTASVAASTVAQDLGNGSVKSGVGTSAMVLGWFGFCLLVV--VTVGLLVM 232  Uncinocarpus reesii 1704
Q0U808        203 VSVLWQHTASVAAATIAQDLGNGSVKSGVGTSAMVLGWFGFVLLII--VTIGLLVM 256  Parastagonospora nodorum SN15
XP_002373515  201 VSVLWQHTASVAASTIAQDMGNGSVKSGVGSSAMVLGWFGFGLMVV--TTIGLLVM 254  Aspergillus flavus NRRL3357
Q0CSC3        353 TAILWQHVAAVAHSATAQAAFNSIVRGNVGSVAMGLGWGSIGLKLI--VALGLMLT 406  Aspergillus terreus NIH2624
XP_010759250  192 VSVFWQHISSAAGVTMGEELNYGAVEGHIGAVSMVLGWGGVFGTAL--VFVGLIIM 245  Paracoccidioides brasiliensis Pb18
EEH10556      214 VSIFWQHISSSASVTMNEELYYGVVRSHSGVVAMILGWGGVFAAFL--VVLGLVVM 267  Histoplasma capsulatum G186AR
XP_002563772  196 ITILWQHVNSSATATMAEILTYGAVSGHVGGVAMTLGWLSIGLIVL--VCVGLWAL 249  Penicillium rubens Wisconsin 54-1255
XP_002385236  211 ISILWQHINSSAAGTMSESLTYGAIESHVGTAAMVLGWAAVVCLGV--VALALLVM 264  Aspergillus flavus NRRL3357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap