5U73


Conserved Protein Domain Family
Sterol-sensing

?
pfam12349: Sterol-sensing 
Click on image for an interactive view with Cn3D
Sterol-sensing domain of SREBP cleavage-activation
Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.
Statistics
?
PSSM-Id: 403533
View PSSM: pfam12349
Aligned: 25 rows
Threshold Bit Score: 159.681
Threshold Setting Gi: 74675993
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5U73_A              649 LVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIeVIPFLVLAVGVDNIFILVQAYQRDERLQGEtlDQQLGRVL 728  human
O43043              257 DIRAKFGLTATIFIQSGTAYFSTCSLLYFFERTGPICPWpMAYYIIIFMDIENSFRLLRAVIASPQTKRV--PSRIMEGF 334  Schizos...
Q2HB50              263 AVKSRVGLMVTMLAQITASIVSSFTVCAIFKVDLSHVPLqTYPFVILAISMENSFRLINAVIMTSSAISI--SDRIGEAF 340  Chaetom...
Q7S7Y9              309 aVKSRFGLMATILAQIAASIGSSFTICAIFKIDLSRVPYyAYPLVVLAISMENSFRLINAVIMTSSSISI--SDRIGEAF 386  Neurosp...
KIS69227            410 KVHSRFGLAFTGTTQLIISMIMSVSICALLGIRLTLVPWeLLPFVIVVVGSENMYSLTKAIVDTPLSLTV--SSRIAHGL 487  Ustilag...
Q18968              295 MVASRWGLAFASSFTVASTLLMTTGICAHLDLSTTTWGSeVYPYIALIMGLENTLCITRSVVYTSPSLDV--SSRIAHGL 372  Caenorh...
FlyBase:CG33131-PA  390 VFRSRFLLALCSVITTAGSLAMSLGLCFFFGLTISLQSKdIFPYLVILVGLENSLVITKSVVSMDETFDV--KIRVAQAL 467  fruit fly
Q17N28              360 VIRSRLVLAFSAVLTVLGSLTMSLGMCFFFGLTISLQSKgVYPYLVILVGLENVLVITKSVLTTDSNLDV--KIRLAQGL 437  yellow ...
AAH27207              1 MVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGeIFPYLVVVIGLENVLVLTKSVVSTPVDLEV--KLRIAQGL 78   human
Q03602              288 IVKSQPFIGFFAMFNATMATIASTSLLLYLQYPFLPLVF-IMPFLVVSIGTDNMFLMLKSWRMTKKSSNE--EQRYIHAL 364  Caenorh...
5U73_A              729 GEVAPSMFLSSFSETVAFF-LGaLSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQ-EKNRLDIFCCVRG 803  human
O43043              335 SSTIIASFSSLLKKLLTLFvLS-FFVYPLVQEFCLFLACSFVVSFLLHGSFFLAVLSVDIRRLeLQDFLDSNSSNRN 410  Schizosacc...
Q2HB50              341 GTTAHIAIASPIQNSLILYgLS-KTGSLGVSSFCAFATIATFFDFFYLATFFLAVLSVDVRQReLCE-LEKASLKRA 415  Chaetomium...
Q7S7Y9              387 GQTAYVAILNRLQNLAILLgLS-RITFPGVAAFCTFAAVAIVFDFLYLATFFLAVLSVDVRQR-ELYELEKASLrkt 461  Neurospora...
KIS69227            488 GKVGVPITLTTLADILLLLvIAlFIEVRAVREFCIFAIFSLIMDWFLQMTFFVTVLSIDMQRLeLADLLTQGTRLSR 564  Ustilago m...
Q18968              373 SQEGYKLTKYYILELLALL-IGfLTRISDIQEFCQFSVICVTVDFYMQLFFYAPCLTFDLQRLgLEEKRKFAEILLY 448  Caenorhabd...
FlyBase:CG33131-PA  468 SKEGWHISKTLLTEITILT-IGlATFVPVIQEFCIFAIVGLLSDFMLQMLLFSTILAMNIKRTeYTAEAKHLPKMLL 543  fruit fly
Q17N28              438 SREGWSITKNLLTEITILT-IGlCTFVPVIQEFCIFAIVGLVSDFFLQMMIFSTVLALNIKQVeYSAEVRQLPKMLY 513  yellow fev...
AAH27207             79 SSESWSIMKNMATELGIIL-IGyFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRM-ELADLNkrlppea 153  human
Q03602              365 TESAASLFLTSLTDGLSFA-IGsISDFHAVRVFCTYCAMAILFMFLFQVTFFNAVMSLCCRRE-VSGKHPVFCCYEI 439  Caenorhabd...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap