Conserved Protein Domain Family
HJURP_mid

?
pfam12346: HJURP_mid 
Holliday junction recognition protein-associated repeat
Vertebral Holliday junction recognition proteins carry an SCM3 domain at their N-terminus as do the eukaryotic fungi, but they also carry this central, conserved region. The function of this family is not known. Further downstream there is also a repeated domain, also of unknown function. Investigation of Scm3 and associated proteins is likely to be directly relevant to understanding the mechanism of HJURP-mediated CENP-A chromatin assembly at human centromeres.
Statistics
?
PSSM-Id: 372060
View PSSM: pfam12346
Aligned: 13 rows
Threshold Bit Score: 143.009
Threshold Setting Gi: 1040118005
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001178742 254 MSRLLRSKPSCIISTKT-SINRNWKLKRRLsrKHGVHKNTTYCHRSKPFQRSSRKGPLHCSEPRKEARVLRDSKNLPHVD 332 Norway rat
EHB11957     249 MSRLLSAKPSCIISTKT-FIVQNWSSRRRQprRSGVQMNETYCKGARPSRRSTKERSTPYPEPRRERGTVGDSRNLPHVP 327 naked mole-rat
EGW13599     259 MSRLLSLKPSCIISTKT-YINQNWNPRRRLsqKSRVHMNRTYSHRSKPFQRSSKKGPS--SKPGKE--VLRDCKNLLHTA 333 Chinese hamster
XP_006529784 178 MSRLLRSKPSCIISTKT-YINQSWKLRRRPsrKQGLHKNRTHCPRSKPSQRSARKGPASCSEPGKEAGILRDYGNLLHVA 256 house mouse
XP_017193023 252 MSRLLSAKPACVISTRA-SVLQAWSCRRRH--RWRSRLNRTYCEAGRRSRGSSSHPPLPGPEPEPGAGPLRDCKNLLDVS 328 rabbit
XP_010595907 246 MSRLLSAKPSCIISTKT-FI-QNWHCRRRS--GWKSRMNRTYCKGGRHTQRGPEEQRSPYSKPAKEVGTLNDPKNSLDVS 321 African savanna...
XP_023364523 272 MSRLLSTRSSGIISTKT-FIMQNWNSQRRH--KCK-RMNRTFCRGARRPQRGSRERPSPHSEPGKERGALRDCKNLLDVS 347 small-eared galago
BAE02517       1 MSRLLSTKPSSIISTKT-FIMQNWNSRSRH--RGKSRMNKTYCKGARRSQRSSKENFVPCCEPVKDTGAIRDCKNVLDVP 77  crab-eating mac...
XP_004777604 260 MSRLLSTKPACIISTKTsFIAHSRSARRRH--KCKNRMNQTPCQGAGLSQSVSRETLPSCSKPLKDRKVLRDCENFLDAS 337 domestic ferret
XP_013963078 263 MSRLLSTKPSCIISTKTsFIAHSWNSRRRH--KCKSRMNRTRCRGAGPSRRGPQDRLPPCSEPGKNREVLRDCENVLDAS 340 dog
XP_012001123 260 MSRLLGARPSCIISTKT-LIGQNWSSRRRH--RYKGRMNRTSCQGGGRSRRSPRERRPPCSKPLEDAGTLRDRGNLPDVS 336 mouflon
XP_001925760 262 MSRLLGARPCCIISTKT-FIGQNWSSRRRH--RCKSRMNRTSCRGGGRSRRSPRESRPPASEPRKHTAVLRDCENLLDVS 338 pig
EFB20642      82 MSRLLSAKPSCIISTKTsFIAHSWSSRRRH--RCKNRMNKTHCRGSGPSRRGSQDRLPPWSEPLKDGEVLRDCENLLDAS 159 giant panda
NP_001178742 333 PHktdKTGLELESVPLEGSKLQVHKLSPAWKE---LQGLPQKYL 373 Norway rat
EHB11957     328 CP---KTGFELEKAFLDENKPQLHKFDPSWKE---LQVTPRKRS 365 naked mole-rat
EGW13599     334 P----KTDLKLERGSLEGSKLQVYKFNPAWKE---LQVMPQKYL 370 Chinese hamster
XP_006529784 257 PH---KTGLELKSVSLEGSKRQVHKSSPAWKE---LQMMPQKDL 294 house mouse
XP_017193023 329 RR---KAGFKLERACLEGNKSQVQTSDPGWKE---LQLTPRRNS 366 rabbit
XP_010595907 322 CR---ERGFRLKKALLEVNNRQVHELVPTWKD---PKVTPQKYS 359 African savanna elephant
XP_023364523 348 CH---NTSLKLRKAYLEV-KPQVHKLDPSWKElqvLQVTPKKCS 387 small-eared galago
BAE02517      78 CH---TTGLKLEKAFLEVNKPQIHKLDPSWKE---LKVTPSKYS 115 crab-eating macaque
XP_004777604 338 GQ---KAAVELEKAFPEVNKPEIHKLDPRWNK---LRglkslmp 375 domestic ferret
XP_013963078 341 GQ---KADLKMEKAFPKVNKLKVCKLDPSWRE---FKGlrslms 378 dog
XP_012001123 337 AP---KTGLKSERALLKVNKPQIHTFSPPWKE---LQGMPRKHS 374 mouflon
XP_001925760 339 GH---KTGLEEGPSFLGVSKPHPPAFAPSWKG---LQRTPPKLS 376 pig
EFB20642     160 GR---KVGLKLEKAFPEVNKPEIRKLNPSWKE---LRGLRSLMP 197 giant panda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap